Protein
- Protein accession
- 8Dhuz [EnVhog]
- Representative
- 4UqBP
- Source
- EnVhog (cluster: phalp2_37918)
- Protein name
- 8Dhuz
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 93% (predicted by ML model) - Protein sequence
-
mstpawmiaaqtykgvtevrghkhnnkiileyfdavghgyikndevpwcaafvgacleeanykgtgalnarsylkwgkkvtkprygdvvvfwrgkkngwqghvaffvketksyvyvlggnqnnevnitryaksrllgyrrpstmstsrtvvgaavggvstgaatvadtlqktqetllgipldyvqylavaltiaglglvlyarwddlknkgr
- Physico‐chemical
properties -
protein length: 212 AA molecular weight: 23401,6 Da isoelectric point: 9,72 hydropathy: -0,22
Representative Protein Details
- Accession
- 4UqBP
- Protein name
- 4UqBP
- Sequence length
- 210 AA
- Molecular weight
- 22177,73190 Da
- Isoelectric point
- 6,96831
- Sequence
-
MQNVYDAANGYLGLEEWPGARHNPQVVGFAEAVGHAWVQDDETPWCASFVGAVLAQVGLPHTGKLNARSYLDWGVPVDIADAEQGDVVIFSRGDPNGWQGHVAFFHGIDGSGNILVLGGNQGNRVSIAPYPRSRLLGVRRARAARQSVAQSTTVQASVAQIGTAGAGAASAVAALDGQAQIVALVVFGVIAVAALWIMRERIKKWSRGDR
Other Proteins in cluster: phalp2_37918
| Total (incl. this protein): 157 | Avg length: 198,7 | Avg pI: 8,49 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4UqBP | 210 | 6,96831 |
| 17f8Y | 205 | 9,11720 |
| 1E4XB | 257 | 6,43516 |
| 1IXAR | 196 | 9,78541 |
| 1KQad | 178 | 9,83074 |
| 1Kt2M | 189 | 9,83048 |
| 1LovP | 183 | 6,52008 |
| 1MGzq | 198 | 7,83989 |
| 1N9bt | 219 | 8,73200 |
| 1NN6O | 225 | 10,11788 |
| 1OmLF | 138 | 9,01102 |
| 1PWNP | 162 | 8,33275 |
| 1XDSq | 165 | 9,15279 |
| 1Y5mT | 168 | 9,54334 |
| 1apsA | 144 | 9,48770 |
| 1cYph | 174 | 9,54475 |
| 1dHgH | 174 | 9,54475 |
| 1eCG9 | 215 | 9,80108 |
| 1fYjQ | 218 | 9,68046 |
| 1fn0s | 234 | 5,31470 |
| 1hcWX | 222 | 9,26457 |
| 1jo2J | 178 | 6,42442 |
| 1qTHN | 209 | 9,26528 |
| 1qUx7 | 207 | 7,80707 |
| 1r59F | 222 | 9,12648 |
| 1rmLX | 168 | 8,62660 |
| 22Wmy | 180 | 7,02276 |
| 26XPI | 222 | 8,94803 |
| 2JLWB | 222 | 6,91369 |
| 2JTrQ | 210 | 9,29616 |
| 2K9Er | 169 | 9,40737 |
| 2LIP | 221 | 7,87683 |
| 2O3qh | 138 | 9,01076 |
| 2QHXd | 209 | 8,50675 |
| 2RAyS | 205 | 8,42558 |
| 2Vx6u | 229 | 6,96018 |
| 2aW8K | 213 | 6,33041 |
| 2ciXp | 222 | 9,06485 |
| 2cjVQ | 221 | 8,60970 |
| 2dD4F | 209 | 9,34290 |
| 2fHlC | 223 | 7,89842 |
| 2rRu5 | 213 | 7,75644 |
| 30uww | 147 | 7,76281 |
| 3Anvp | 141 | 9,13544 |
| 3NoqH | 214 | 9,73384 |
| 3OYQn | 178 | 7,90971 |
| 3QdyY | 222 | 9,75241 |
| 3aU9L | 213 | 8,57992 |
| 3aVqI | 188 | 5,95413 |
| 3aZ1q | 213 | 9,36637 |
| 3fZ8 | 263 | 9,72262 |
| 3iJtC | 222 | 7,88308 |
| 46KEm | 210 | 9,38442 |
| 48mAZ | 220 | 9,31783 |
| 4B8bA | 205 | 7,82493 |
| 4By16 | 222 | 8,64058 |
| 4F9mQ | 136 | 9,50710 |
| 4FgZN | 263 | 8,66921 |
| 4KsdS | 183 | 10,06295 |
| 4PpAl | 217 | 6,85094 |
| 4Pu4q | 211 | 7,77167 |
| 4QFj0 | 209 | 9,14299 |
| 4QIdp | 222 | 7,89359 |
| 4UXGy | 214 | 8,85971 |
| 4UYd9 | 183 | 8,73303 |
| 4UoTw | 239 | 9,25942 |
| 4Uok5 | 226 | 8,92612 |
| 4Urm8 | 183 | 6,30773 |
| 4UsHG | 212 | 6,28715 |
| 4Utvs | 195 | 5,64823 |
| 4WBnT | 210 | 7,83183 |
| 4WqPs | 212 | 9,03874 |
| 4WvZi | 157 | 8,45227 |
| 4X0jv | 209 | 7,88553 |
| 4XsNO | 205 | 8,88415 |
| 4eQXu | 185 | 9,28063 |
| 4etGv | 218 | 8,67050 |
| 4f51y | 138 | 8,49224 |
| 4g4VG | 271 | 9,24710 |
| 4gVQp | 266 | 9,29739 |
| 4rYyh | 139 | 9,60484 |
| 4tGwG | 192 | 7,63373 |
| 4tOWF | 222 | 6,37793 |
| 4uDOS | 195 | 9,57422 |
| 5Fi14 | 209 | 9,32969 |
| 5Fimc | 214 | 6,15785 |
| 5Fl5r | 214 | 9,36553 |
| 5FmYe | 214 | 9,09354 |
| 5FmaQ | 214 | 8,99858 |
| 5HebB | 197 | 9,27502 |
| 5I6dk | 139 | 9,79547 |
| 5bqoR | 150 | 7,84943 |
| 5jq0K | 222 | 7,88669 |
| 5jq27 | 210 | 9,13009 |
| 5jq4V | 157 | 6,96303 |
| 5jqEt | 178 | 9,12706 |
| 5jsBh | 205 | 7,92499 |
| 5mxwm | 169 | 9,71237 |
| 6B22h | 216 | 9,66396 |
| 6Gfpb | 151 | 9,09676 |
| 6IGNk | 217 | 9,80108 |
| 6NNyj | 214 | 9,14930 |
| 6Oly0 | 214 | 9,14647 |
| 6SD7n | 173 | 9,65029 |
| 72ATf | 198 | 9,34045 |
| 7BaqM | 224 | 9,46043 |
| 7FvIF | 220 | 8,99110 |
| 7USUh | 196 | 7,85207 |
| 7Vu6Y | 251 | 9,40892 |
| 7Ylnd | 191 | 9,18541 |
| 7gjv | 222 | 4,54464 |
| 7rR7t | 205 | 7,83305 |
| 8BvXT | 209 | 6,57840 |
| 8Cvnf | 212 | 9,23788 |
| 8DiJL | 169 | 9,41105 |
| 8FU3Q | 209 | 9,29977 |
| 8aQGx | 162 | 8,45015 |
| 8d1NG | 211 | 9,24936 |
| 8dNv5 | 170 | 5,76134 |
| 8eIHL | 215 | 8,27041 |
| 8kcGR | 168 | 7,86535 |
| 8ky28 | 201 | 9,71366 |
| 8mA4u | 162 | 9,29836 |
| 8pPDO | 168 | 9,38436 |
| 8qSH9 | 142 | 8,58237 |
| 8rQvY | 221 | 5,96743 |
| 8s4dc | 222 | 7,87380 |
| 8s7Ew | 165 | 9,82364 |
| 8sJtD | 151 | 7,71347 |
| 8yB8U | 209 | 9,16555 |
| 8zMcQ | 212 | 9,69555 |
| A7dA | 170 | 6,29687 |
| A9Uk | 209 | 6,90812 |
| AAYE | 213 | 9,47571 |
| AmAU | 142 | 9,71237 |
| AsOp | 169 | 9,27779 |
| Rtb8 | 139 | 9,59182 |
| TBWT | 145 | 9,22248 |
| bUMv | 210 | 8,49166 |
| cqlA | 205 | 8,52970 |
| fSMB | 209 | 7,75599 |
| iqe9 | 222 | 7,89314 |
| k2Ab | 212 | 9,67833 |
| l3wO | 242 | 6,42902 |
| nFuP | 209 | 9,14724 |
| sBhJ | 162 | 8,88627 |
| wBZe | 229 | 6,58863 |
| wKs | 208 | 7,88553 |
| xEW3 | 214 | 9,33298 |
| xX7z | 168 | 6,28426 |
| xyiy | 152 | 8,77449 |
| y6DO | 216 | 9,25710 |
| zVWM | 210 | 6,43124 |
| A0AAX3ZVZ9 | 211 | 7,84698 |
| A0AAX3ZZD4 | 210 | 8,67095 |
| A0AAX4G2M0 | 210 | 8,75708 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_19771
7LzfF
|
669 | 52,8% | 138 | 4.013E-67 |
| 2 |
phalp2_32686
8dG3n
|
26 | 47,2% | 161 | 4.222E-58 |
| 3 |
phalp2_8523
1pCMB
|
7 | 40,2% | 184 | 7.921E-58 |
| 4 |
phalp2_31967
4Vkzp
|
33 | 46,6% | 135 | 1.862E-53 |
| 5 |
phalp2_17303
4eTLb
|
16 | 39,3% | 173 | 1.109E-51 |
| 6 |
phalp2_32166
6PqA1
|
486 | 50,3% | 141 | 7.313E-51 |
| 7 |
phalp2_21703
3iJm5
|
22 | 44,5% | 155 | 1.694E-49 |
| 8 |
phalp2_38999
8dFXu
|
7 | 43,1% | 139 | 5.371E-48 |
| 9 |
phalp2_37558
3GCv7
|
1 | 34,2% | 228 | 7.353E-48 |
| 10 |
phalp2_35973
5kZXR
|
1764 | 36,9% | 157 | 2.327E-43 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4UqBP)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50