Protein

Protein accession
8BggJ [EnVhog]
Representative
d8Lo
Source
EnVhog (cluster: phalp2_26149)
Protein name
8BggJ
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
msrslddlipsflspvqdalsrceseghelrvfytrrdvweqarlwrqsrtggeirsairkleqsgagwlaevvhdvgpqygrwatnalpglswhqhgeavdafvsvrgravwasghpgyrawaeaakaaglvsgyfwdkrdavhvqarrdrvrnlyswqeldqlmqaefgpqapaypag
Physico‐chemical
properties
protein length:180 AA
molecular weight:20316,4 Da
isoelectric point:7,96
hydropathy:-0,54
Representative Protein Details
Accession
d8Lo
Protein name
d8Lo
Sequence length
181 AA
Molecular weight
20207,16850 Da
Isoelectric point
8,56541
Sequence
MSKDLNDLAPTLHGICIEHLHISALEGIDMRILQTWRPLEKQARLYRSTRSIEEIRAKAKALAHLGCQHCADVLISVGPQLYPPWLQPGKHLTMAGPGESKHHKLDIFHGIWACAYDIGCFDKDGKYIQDGKHPDYVTAGRIGTGLGLQWLGEGTQKFKEAAHFQLKGLPGTKERIKLVVE
Other Proteins in cluster: phalp2_26149
Total (incl. this protein): 162 Avg length: 169,9 Avg pI: 7,55

Protein ID Length (AA) pI
d8Lo 181 8,56541
107bJ 173 5,02044
107xC 176 6,83332
16y4w 190 6,04712
17Y03 141 8,90761
17jDm 183 6,15841
18BIw 139 8,93404
19y56 176 10,19634
1E9BO 166 6,96360
1FQTw 186 9,22699
1HQbc 168 9,84821
1HSEP 188 8,83734
1I9Vs 170 5,34164
1Jaff 165 6,17979
1Jbyv 171 8,83218
1KH2j 169 5,30117
1Kl7i 141 9,48067
1LEcI 182 8,24037
1MUk4 176 6,05860
1QYMH 173 8,15159
1RiCz 168 9,38597
1VnA6 175 8,70924
1Z0aH 179 7,66681
1azyU 139 8,58314
1ibBH 170 9,25929
1jlKd 183 7,01151
1laEg 177 9,11037
1lgoX 182 8,55168
1lic1 165 5,90258
1lrBO 173 5,27531
1rddx 139 7,09592
1soXh 139 7,81088
1xyXj 181 6,59323
20LWo 175 8,41707
23tL 170 5,23052
2JHgx 170 5,89565
2V80c 172 5,83506
2aqtO 139 8,92818
2ctif 177 7,69273
2cvE2 164 9,46817
2k1Bl 182 9,61270
2k1fz 174 5,73093
2kYqj 181 4,63138
2l2bg 176 9,20849
2l2tT 177 6,53992
2ntat 188 6,07424
2sjkv 172 6,40930
2tAwY 163 8,89691
2yvei 185 6,47455
2zBzi 188 9,71179
30dvM 139 8,95152
31avs 139 7,12530
35j56 170 4,98611
36kDL 167 6,47569
39GR9 192 5,82767
39wda 131 6,35968
3CIRM 164 5,36585
3LHLh 174 7,83247
3S1om 172 9,00032
3Vi6g 170 5,12258
3XAV 187 5,20596
3Xo1E 175 7,01475
3Xzsj 173 6,30148
3YjAd 174 4,79110
3dh58 160 7,67903
3erqg 180 9,32608
3f332 133 4,94473
3f469 158 8,90561
451dm 143 8,94217
45OQC 190 6,53696
45P1W 169 5,35477
45PB4 172 9,74370
45Q3Z 171 7,71421
46n6w 139 9,22867
47R37 174 5,40416
47SnM 175 6,89726
47TMa 172 9,29848
47U1n 190 7,67448
4BpE 171 8,37794
4Buup 210 8,22850
4CKU2 161 5,06517
4CM2d 166 5,91821
4Dt8H 175 6,43471
4EIgl 160 7,19368
4EPTd 134 4,96320
4FIks 141 9,32369
4Gbrh 139 9,35728
4GiBg 139 9,26122
4H62M 179 8,88299
4HVdW 181 5,96783
4HsWI 213 8,60332
4JV73 192 6,30159
4KJ24 166 4,80678
4LUTG 234 9,39042
4NdpD 157 9,50859
4NpCh 139 9,55107
4Npc8 139 9,39009
4OVxk 158 8,83186
4UY7H 177 9,15298
4XGo8 181 7,11513
4XpMx 182 6,58942
4Y8lc 181 7,74399
4aImv 142 9,55127
4cax2 171 5,62333
4ctH8 139 9,42555
4gLbP 172 6,10391
4irsk 173 9,12932
4jzRf 171 8,93772
4qizt 196 7,79702
4yXRf 160 8,42687
4yYyH 154 6,12573
4zL2t 170 8,65954
4zciU 143 9,01102
53D7X 141 9,44812
5CSDw 201 9,13229
5DQL0 186 6,72220
5GDz 177 7,78773
5HjQN 139 9,26122
5JE0m 168 9,00122
5T7fI 177 7,64379
5cpSq 196 9,16117
5dHKL 175 7,68363
6ALwK 172 6,52218
6LuSc 180 9,04364
6NUBF 181 7,82699
6NVvB 178 5,07904
6U0QF 143 9,00032
6VPzE 167 9,40337
6yeHT 141 9,47990
6yi8J 141 9,47990
7UQ5E 179 5,97318
7W1HT 190 7,77423
7e2K8 176 8,70505
7eNm 168 9,79392
7lpM 187 5,31242
7lw7I 176 6,90363
7mlJJ 180 6,05633
7oeJh 181 6,52508
80245 172 9,07858
85LDB 213 7,72836
87mis 141 8,92863
89GSi 186 6,37662
8Bg9W 158 5,59218
8CKmD 134 6,73027
8D73K 170 8,68765
8eW0w 190 8,79234
8l8PL 177 5,42667
8pKMl 173 6,20065
8pQxE 177 8,75985
8w8i9 175 8,70924
A5Fx 175 6,04633
IivR 170 4,69487
UDhD 180 7,80056
UJG4 181 8,36292
ULLa 174 7,01248
VRtJ 181 7,14423
f5lW 183 5,84779
h1cw 134 5,48345
i8Px 185 6,19843
ig86 176 8,69338
jjtZ 186 6,16001
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_1337
15l6q
1516 29,3% 167 3.497E-43
2 phalp2_32329
8CRp5
10 22,1% 221 8.234E-39
3 phalp2_35414
f7cN
32 24,2% 169 8.291E-30
4 phalp2_27726
6US3d
23 23,2% 172 2.339E-27
5 phalp2_39989
1NC6w
21 23,6% 165 2.564E-25
6 phalp2_33559
8Bkl8
2 26,6% 150 1.675E-24
7 phalp2_15634
2Dd0a
83 22,6% 168 1.495E-23
8 phalp2_23122
4DyQf
2 29,8% 124 2.488E-22
9 phalp2_33807
1hNOs
60 18,5% 167 2.488E-22
10 phalp2_627
1bpyM
18 25,4% 169 2.488E-22

Domains

Domains
Unannotated
Representative sequence (used for alignment): d8Lo (181 AA)
Member sequence: 8BggJ (180 AA)
1 181 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (d8Lo) rather than this protein.
PDB ID
d8Lo
Method AlphaFoldv2
Resolution 94.94
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50