Protein

Protein accession
8A0T4 [EnVhog]
Representative
P68n
Source
EnVhog (cluster: phalp2_9483)
Protein name
8A0T4
Lysin probability
96%
PhaLP type
endolysin
Probability: 90% (predicted by ML model)
Protein sequence
mipqefkehikhregfrdkvyldtldkptcgvghllspaeneqynigdtvpqdildewllqdsnkawqaavaqaeeieiesteflvalasvnfqlgtswmnkfpsayqalkdkdyeeairqvstgsgkdgqskwkeqtpvrvkdfvdaiqaltnh
Physico‐chemical
properties
protein length:155 AA
molecular weight:17596,4 Da
isoelectric point:4,79
hydropathy:-0,62
Representative Protein Details
Accession
P68n
Protein name
P68n
Sequence length
208 AA
Molecular weight
23097,83040 Da
Isoelectric point
6,33820
Sequence
MTMTNGKVPTESFLKHLKDREGSVDRIYLDTKDKATSGVGHLMSNDEMKTYGVAGYADEIINNVKYKVAIDKDGKVIKPGSTKIDEWLRADATKYYNYGSKLAAEAGITDQGMIEALGNVSFQLGESWHREGSKKFPKAWKAIKSGDYTQAVKEIKESNAEGGWMKDTPTRANDFIDAINAYGKKMKPQDYAIEEMKAMDDPLGLSYG
Other Proteins in cluster: phalp2_9483
Total (incl. this protein): 280 Avg length: 169,9 Avg pI: 6,72

Protein ID Length (AA) pI
P68n 208 6,33820
10jnq 226 9,23601
11237 165 7,55614
12q5z 172 9,32808
17v7E 170 8,79292
1Ex9Z 152 5,04045
1Fe1L 170 6,30256
1Fq6s 170 6,30256
1MGv7 173 9,68504
1Smpj 152 5,71865
1Tvsj 155 5,23222
1UEAe 164 6,90192
1UEua 152 5,04045
1Vm8O 164 6,95524
1VqeM 162 7,66351
1W6YZ 151 7,70671
1W9bq 166 5,50334
1Wa9d 170 8,31747
1Wr3V 152 5,25894
1WrSw 166 5,45185
1Ws9E 152 5,57462
1YUpx 185 7,91287
1febf 153 4,89613
1g9uP 165 7,62020
1gNwp 158 9,39706
1i40m 204 8,89910
1lxiv 140 8,53924
1n5Bu 164 6,33228
1n5we 163 5,27951
1n6xn 201 6,00881
1oLNn 147 9,30222
1rZl0 161 6,90300
1wiO4 152 5,40410
214LH 153 4,55720
28ruM 176 8,50946
2BI9a 154 4,80144
2IZHz 153 5,07444
2K3ME 183 6,43141
2La0I 195 9,31654
2Nhni 185 7,91287
2OVYI 155 6,83656
2QrgI 215 5,31669
2gq6S 171 8,98001
2vO5X 167 6,33490
2vmap 203 5,49095
2w5YL 225 5,59349
2wnyV 237 4,63820
2xbgE 176 9,17780
2xca4 153 5,21932
2xdEz 159 7,66800
32FOq 226 9,23601
33Q4K 226 9,23601
34hdF 161 9,15440
353ow 178 7,84388
39CzF 200 9,35883
3BEuO 158 4,74233
3BHQj 170 6,43306
3BIuQ 164 7,63179
3BKhV 170 8,55819
3BL38 153 4,62069
3BrjK 152 4,85299
3BzIy 164 7,61315
3C8Vz 152 5,71859
3CBUB 153 4,74614
3CKIG 170 6,90369
3Cip9 153 4,99157
3CkNP 170 8,62692
3Cm1U 153 5,12411
3Cwxx 165 6,22548
3D8he 164 7,63532
3DAa4 164 6,90045
3DY4C 164 8,24301
3Dhps 165 6,52497
3FY1M 163 5,89224
3GSRh 217 9,58253
3GViX 223 4,89881
3H1Vl 169 7,69369
3H8rR 167 6,91199
3HPm9 203 5,32646
3HQSk 203 5,69677
3Ha9l 167 8,58772
3IuoH 170 6,32234
3IyM7 181 5,86814
3IzmX 166 6,59721
3JZuy 170 6,90198
3Jiy6 203 5,31538
3JqzE 146 4,92217
3KhBe 218 9,43226
3L9Hx 167 6,96746
3LZ1m 153 4,67429
3UbHg 163 8,99471
3UnP4 176 5,72445
3V3QK 142 9,06195
3YilL 175 6,07873
3ZcMC 153 4,77046
3gBch 153 5,01885
3hLNI 209 5,83102
3jeE3 152 5,05039
3jrIS 167 8,29458
3jw15 159 5,08529
3mNtl 152 5,19613
3ouDa 153 4,67429
3rF5L 153 5,12411
3rFV0 181 6,95768
3rG8i 169 9,25394
3rI3a 168 9,40402
3rwtG 165 6,90295
3ryU7 164 6,90534
40ATK 153 5,20937
42HtV 153 5,44094
42Q4q 204 9,69619
45P0y 153 4,68685
47l8c 146 4,55015
4Jhas 195 4,98776
4JnxL 190 5,29588
4OQ0X 196 9,28398
4PmfT 191 5,33118
4QHSD 210 9,78168
4QYsI 182 7,69761
4R4m3 165 8,55465
4RgiH 153 4,67975
4SlcQ 153 4,75927
4fSgL 143 9,54733
4jErj 222 4,73437
4t3VP 182 6,10146
52DJ 166 8,83960
58GK 153 4,97736
5q8Sc 153 4,67105
5qUIo 170 7,69335
5r3gJ 164 8,23392
5r4xc 240 5,88775
5rWg7 169 7,65055
5s9G2 154 5,11695
5yH6C 187 8,60010
6CuvV 153 4,96480
6HNkt 153 4,84049
6Joix 196 9,34658
6N5d5 153 5,34772
6Vrgt 164 6,44676
6WNo7 141 9,17696
6Wbzu 203 5,96573
6Wtk7 156 5,63498
71yMa 158 8,48831
7CPaR 149 4,85083
7CWFq 225 4,96474
7EP4N 152 5,71859
7GWsg 176 9,25349
7H3rO 159 8,29271
7H6IS 164 8,71995
7H6Pr 176 8,92412
7HaGq 172 9,21506
7Hb5e 164 9,14441
7TFGA 164 8,53202
7TPO9 152 5,65715
7TRqA 188 9,37965
7TkUv 169 6,12567
7Txz7 153 5,57462
7Tzyx 161 5,98341
7U1Cq 153 5,12411
7Uahc 153 5,23757
7V8Ny 166 7,67812
7VAu2 152 5,05290
7VPge 152 5,11405
7WnCW 152 6,07651
7Wvx2 218 9,31621
7Y9V9 132 7,96947
7YGiJ 164 7,61093
7Yay9 152 6,70515
7Z8t7 165 9,11559
7ZHK9 167 5,50806
7ZpgW 156 5,95362
7b0AR 132 6,57561
7jIz0 132 7,81384
82K8q 155 5,95362
83iTF 164 6,33194
83zyM 164 6,82843
846L6 152 5,94805
846Rm 164 7,64697
8483t 152 5,54177
84VM7 170 6,32643
84qkw 131 5,44821
86NJj 134 6,30409
86a72 164 5,22370
89Op2 174 9,31447
89PFJ 153 5,12411
89oyJ 153 4,68856
8APug 153 5,10127
8AV1T 200 5,31094
8AWgY 187 9,22196
8Abiz 192 5,95817
8Bdby 153 4,64360
8BmmD 153 4,85299
8CQ8G 153 4,99157
8CQpv 153 5,07779
8ChS8 152 5,71865
8D5n1 216 9,18683
8DUy9 153 4,74614
8E1rN 152 5,94498
8ENkh 152 4,69032
8Ej0z 192 5,96573
8EnxW 217 8,52506
8FPvc 153 4,71215
8FUqY 152 4,96480
8FdUN 187 8,60010
8FeFS 217 8,82741
8FgWQ 150 4,96553
8GDcQ 120 4,88289
8GR6T 152 5,11405
8GTnB 218 8,47310
8Gf1L 203 5,69677
8Gi6u 154 4,82787
8GxG7 188 9,37965
8HiDE 165 7,79663
8HiDG 166 9,24594
8HiDI 179 9,58040
8HiDJ 165 9,13841
8M3CI 168 8,64510
8cV2l 170 6,12346
8cp9b 164 6,95524
8dgQ 174 7,88650
8fY9r 166 6,19786
8gbab 152 5,64715
8glPW 152 6,07787
8hTR5 174 8,29658
8hlMd 131 6,82201
8hy3R 153 5,12411
8ikKy 218 9,51916
8jJW1 153 5,00578
8jU6U 153 4,55720
8m6U0 146 8,48934
8p5SL 165 8,22715
8pP3l 147 8,50430
8tHJS 153 5,12411
8tZqI 116 6,30233
8trRI 179 5,44457
8u8gB 165 6,22872
8uQAe 153 4,99157
8uTRN 161 6,22111
8uzXa 168 8,86500
8v5ez 232 4,70720
8vh00 152 6,19786
8vxYp 198 7,58723
8wLc7 153 4,96900
8wM7f 153 5,12411
8wNFx 153 5,23757
8xJnd 153 5,38546
8xeyI 153 4,99157
8xxwC 161 9,15440
8yGFy 153 5,06301
8ytpL 226 9,23601
8z61t 152 5,94805
8zUxh 152 5,25894
8zVTs 169 6,12567
8zm30 179 5,44457
9Luh 203 5,49095
9nBX 203 5,69677
HUl1 178 5,52750
PD9e 170 5,14310
QIIb 161 9,21235
WMeA 161 5,03061
WujQ 226 9,23601
WxUK 217 8,52506
Y6uq 226 9,12494
Yze3 173 8,68242
aPzS 160 9,17593
g29a 172 5,61202
jifn 147 5,78998
nXH2 220 9,22164
oZJU 157 4,89187
qPeB 166 7,01020
qYs5 164 7,65209
r0w0 246 4,43375
sd96 205 9,46269
shcj 164 9,21545
slEY 170 6,96223
ulfR 162 8,89852
vT75 187 7,77446
w5Kk 153 4,81383
zJg6 223 4,84043
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_8728
8fOi5
3 30,9% 168 2.644E-48
2 phalp2_38982
870Be
33 35,5% 166 4.470E-47
3 phalp2_4689
4IEff
5 29,9% 177 6.120E-47
4 phalp2_13169
2jweC
13 35,7% 165 1.148E-43
5 phalp2_30730
7scFT
23 27,2% 169 9.229E-39
6 phalp2_13785
6VUL5
2 26,3% 190 8.145E-35
7 phalp2_21661
31ima
875 22,2% 175 4.573E-20
8 phalp2_36948
cxzo
2 24,1% 186 4.573E-20
9 phalp2_2924
QDRo
8927 22,6% 168 7.384E-19
10 phalp2_17935
106Ig
4 26,0% 165 1.006E-18

Domains

Domains
Unannotated
Representative sequence (used for alignment): P68n (208 AA)
Member sequence: 8A0T4 (155 AA)
1 208 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (P68n) rather than this protein.
PDB ID
P68n
Method AlphaFoldv2
Resolution 89.92
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50