Protein
- Protein accession
- 87FwT [EnVhog]
- Representative
- 1fKSs
- Source
- EnVhog (cluster: phalp2_5007)
- Protein name
- 87FwT
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKSQPINLTDAAFWYKQESHQVAAFNYLQSILSEEELENFAEIYRAGPVMPPTNGPLTPDVFAELTGYSADKFTEQECLDANRLLQETDFIRHKDAMCMLLGNILHETGNMRWLKELASGEAYENRADLGNTQPGDGPKYKGAGVLQLTGRYNYSILAKDVNDTKVIEYGCDYVATTYPFMSAYSWIENNKLLHVCLKEGFDKCCYRINGGWNGYEDRKKKYEICKRVFNVK
- Physico‐chemical
properties -
protein length: 232 AA molecular weight: 26525,7 Da isoelectric point: 5,35 hydropathy: -0,53
Representative Protein Details
- Accession
- 1fKSs
- Protein name
- 1fKSs
- Sequence length
- 184 AA
- Molecular weight
- 20638,93040 Da
- Isoelectric point
- 5,38654
- Sequence
-
MSRFSGHPASSFDAQFCNDFNKLLKQTGFNTDLTAFRMLLAQMAHESGNWLYMKECGSTAYFTAMYEGRSDLGNTQPGDGARFSGCGPIQCTGRANFSDSYKYLQQMEGLDDPRFMSEGTPYVGEVYPFQVCIGWLIKNNYFELCKTGDLGSCTKRLNGGTNGLEDRLYWYNKAKQVITEADLS
Other Proteins in cluster: phalp2_5007
| Total (incl. this protein): 166 | Avg length: 233,9 | Avg pI: 5,55 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1fKSs | 184 | 5,38654 |
| 11Qp6 | 241 | 5,29679 |
| 1A2iA | 249 | 5,18306 |
| 1A3ML | 252 | 7,50402 |
| 1A8zu | 265 | 5,45048 |
| 1AbvP | 243 | 5,80584 |
| 1B8J5 | 228 | 6,94921 |
| 1C8d | 228 | 5,15663 |
| 1D2Gf | 235 | 5,66193 |
| 1SKuU | 265 | 4,95132 |
| 1SzQ7 | 242 | 5,34590 |
| 1TM5k | 276 | 5,90713 |
| 1V8es | 247 | 5,60793 |
| 1V9Ze | 243 | 5,14787 |
| 1VNL1 | 236 | 5,97357 |
| 1VSd8 | 244 | 5,48322 |
| 1Vu1l | 246 | 5,89298 |
| 1fKWP | 245 | 5,21085 |
| 1ftrB | 245 | 5,31492 |
| 1gh1y | 192 | 6,23901 |
| 1s7DB | 233 | 5,05312 |
| 1sewI | 221 | 4,83821 |
| 1toGj | 131 | 5,67829 |
| 1uC74 | 227 | 5,27849 |
| 1uZnh | 239 | 4,55709 |
| 1xv9 | 243 | 5,58281 |
| 1yVL5 | 239 | 4,61501 |
| 214xz | 239 | 4,91483 |
| 25Bj1 | 245 | 6,04917 |
| 2OE7v | 228 | 5,04312 |
| 2XhN2 | 245 | 5,95988 |
| 2s4CM | 239 | 4,80985 |
| 2s548 | 239 | 4,83185 |
| 2s5f3 | 228 | 6,94279 |
| 2s7HW | 226 | 5,39052 |
| 2s7bs | 243 | 4,80525 |
| 2tZCg | 228 | 5,06603 |
| 2vXvh | 239 | 4,51867 |
| 2vYOU | 241 | 5,22529 |
| 2vey1 | 228 | 5,26206 |
| 2x6PU | 235 | 5,88564 |
| 2xbBm | 211 | 4,87266 |
| 2zPEk | 244 | 5,76162 |
| 37sZr | 238 | 6,70128 |
| 3CpI2 | 227 | 5,43298 |
| 3GuOI | 226 | 5,26860 |
| 3HMx6 | 227 | 4,90096 |
| 3Jhlm | 239 | 6,06764 |
| 3Xsh6 | 243 | 5,63640 |
| 3Z2gN | 228 | 7,56444 |
| 3aRT4 | 242 | 5,34590 |
| 3aY9P | 227 | 5,63856 |
| 3hEdU | 228 | 5,39990 |
| 3hz3f | 235 | 4,99742 |
| 42E3m | 243 | 5,71962 |
| 438MT | 228 | 5,56717 |
| 43dSU | 235 | 5,10297 |
| 47E4y | 189 | 9,31731 |
| 4Q9Qd | 243 | 5,36142 |
| 4S5f2 | 239 | 5,18220 |
| 4S62B | 235 | 4,94905 |
| 4S799 | 242 | 5,77975 |
| 4Sd2o | 244 | 5,47930 |
| 4Sibd | 244 | 5,57854 |
| 4WTaE | 235 | 5,29259 |
| 4sRPh | 235 | 6,15512 |
| 4sw6H | 235 | 6,37423 |
| 4x3mg | 222 | 4,39140 |
| 4x8y0 | 244 | 4,91660 |
| 6BeIU | 238 | 5,23597 |
| 6BeJS | 227 | 5,74184 |
| 6BkRL | 239 | 4,72840 |
| 6BlNb | 238 | 5,08069 |
| 6CekD | 239 | 4,62876 |
| 6CpvP | 238 | 5,41075 |
| 6NooU | 228 | 4,91495 |
| 6O1hh | 239 | 5,06193 |
| 6OIkh | 232 | 4,68873 |
| 6OMND | 239 | 4,89795 |
| 6OyHg | 252 | 4,71743 |
| 6TzNz | 239 | 4,87544 |
| 6X2Yt | 235 | 5,18897 |
| 6X4P7 | 230 | 5,04715 |
| 6X4np | 236 | 4,80513 |
| 7CKWn | 236 | 4,58653 |
| 7Cnkx | 216 | 5,27855 |
| 7Cu0m | 237 | 5,04681 |
| 7Cw5n | 237 | 5,19727 |
| 7DajR | 239 | 4,90744 |
| 7Dtms | 226 | 6,30642 |
| 7GYKZ | 227 | 6,11124 |
| 7SJme | 232 | 5,15322 |
| 7SVNq | 227 | 5,55950 |
| 7SWGH | 226 | 8,48883 |
| 7UQlz | 239 | 4,57539 |
| 7VgHn | 243 | 5,01748 |
| 7XAFy | 235 | 5,84262 |
| 7YGPl | 227 | 5,42599 |
| 7ZF0V | 226 | 5,26081 |
| 7rBy0 | 226 | 7,53164 |
| 80vGW | 228 | 6,98775 |
| 80wD0 | 226 | 5,82880 |
| 816tS | 239 | 4,79047 |
| 81aRR | 233 | 4,85493 |
| 81vuE | 235 | 6,30733 |
| 82Kf9 | 267 | 5,44202 |
| 85zeQ | 227 | 5,74002 |
| 8A0IA | 239 | 4,82940 |
| 8BqdK | 235 | 5,50397 |
| 8D1QR | 238 | 5,13457 |
| 8EBXG | 235 | 5,08200 |
| 8ELBf | 164 | 5,16305 |
| 8Fnuc | 239 | 4,79007 |
| 8GMzj | 230 | 5,13247 |
| 8HmLb | 227 | 9,01998 |
| 8HmLc | 225 | 6,22804 |
| 8Lx7N | 244 | 4,60881 |
| 8acba | 235 | 5,08200 |
| 8bFZh | 226 | 5,63345 |
| 8bdcy | 227 | 5,23126 |
| 8beh4 | 234 | 5,59054 |
| 8bgUs | 242 | 5,59872 |
| 8bi7R | 236 | 4,52111 |
| 8cKER | 236 | 6,43914 |
| 8cUyl | 244 | 5,59662 |
| 8cWJU | 257 | 5,26451 |
| 8chMA | 245 | 5,09325 |
| 8cp7x | 227 | 5,59866 |
| 8eDZl | 227 | 5,76895 |
| 8edRn | 227 | 6,09811 |
| 8f7BU | 202 | 6,51417 |
| 8gFh6 | 226 | 5,55404 |
| 8gxQo | 227 | 6,22509 |
| 8hwCl | 228 | 5,28122 |
| 8kKdI | 227 | 5,40876 |
| 8kN7c | 236 | 6,52758 |
| 8kt3c | 227 | 5,31242 |
| 8lPpb | 244 | 5,20011 |
| 8pqxg | 244 | 4,84401 |
| 8q2bW | 227 | 5,96675 |
| 8r1qf | 226 | 5,96408 |
| 8t03H | 244 | 5,18482 |
| 8tX5n | 239 | 4,99168 |
| 8tXS9 | 235 | 5,09518 |
| 8tYWV | 221 | 4,60836 |
| 8uF43 | 233 | 4,79468 |
| 8x8Le | 223 | 4,27869 |
| 8xhqV | 235 | 5,08114 |
| 8zuwT | 226 | 8,48883 |
| GU2x | 245 | 5,63680 |
| Hg5I | 240 | 6,22787 |
| TLcZ | 238 | 7,57700 |
| YBlu | 239 | 4,83981 |
| dV4c | 244 | 5,28116 |
| fRZr | 227 | 6,42834 |
| gINU | 222 | 8,50907 |
| gKan | 241 | 7,51306 |
| iAEh | 228 | 5,15208 |
| iqfi | 235 | 5,08200 |
| ixPn | 235 | 7,63742 |
| rt3f | 239 | 5,42979 |
| tOPV | 243 | 4,83964 |
| v3Fw | 235 | 5,22535 |
| vEVd | 235 | 5,50397 |
| xWB9 | 263 | 5,21256 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_20536
4lbpW
|
253 | 39,4% | 185 | 2.948E-56 |
| 2 |
phalp2_6162
5EIXo
|
59 | 39,2% | 168 | 1.907E-42 |
| 3 |
phalp2_10052
7rxm7
|
6 | 32,9% | 185 | 2.612E-42 |
| 4 |
phalp2_37035
K2lc
|
7 | 32,9% | 197 | 5.525E-37 |
| 5 |
phalp2_1654
8rD3A
|
4011 | 42,8% | 140 | 2.662E-33 |
| 6 |
phalp2_8404
IwNf
|
80 | 37,0% | 154 | 4.446E-29 |
| 7 |
phalp2_23279
520Od
|
3 | 30,5% | 154 | 6.082E-29 |
| 8 |
phalp2_12573
1gDri
|
1 | 41,8% | 148 | 6.082E-29 |
| 9 |
phalp2_34955
4E7ip
|
9 | 40,0% | 140 | 1.557E-28 |
| 10 |
phalp2_17227
3zUSo
|
139 | 39,7% | 151 | 1.557E-28 |
Domains
Domains
1
184 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1fKSs)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50