Protein
- Protein accession
- 82sP9 [EnVhog]
- Representative
- EGF4
- Source
- EnVhog (cluster: phalp2_17898)
- Protein name
- 82sP9
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MVQITKKLIKYNHSGINKPVYIVIHETGNADIGADAERHYRYFNGGDRGASAHYVVDDKQVIQLVEHNVQSWHNGKKYVSNPNVAQCNNSNSIGIEICVNQDGDYSKAVSNAVDLTKKLMKELNIPVDKVIRHYDSCGKQCPAKMLREPKIWTDFKKAIQGIQMDKDYEKAIQVLVEANIIGSPAAWQLDKINTNNVSSLIKKMAKYVEDRS
- Physico‐chemical
properties -
protein length: 212 AA molecular weight: 23904,0 Da isoelectric point: 8,88 hydropathy: -0,53
Representative Protein Details
- Accession
- EGF4
- Protein name
- EGF4
- Sequence length
- 304 AA
- Molecular weight
- 32937,58690 Da
- Isoelectric point
- 8,20600
- Sequence
-
MLDIQQKIIKYNFTKGRTGVDYIVIHDTGNTNAGADAEAHYNYFGGANRNASAHYFVDDHQIIQVIEDSNAAWHCGDGKGKYGIKNSNSIGVEICVNQDGDYDKAVSNAVELAATLLKKYNLSLDRLKRHYDASRKTCPASMSANNWAAWELFVSAVKAALDGTTAAPSQKPVVFGHVANVQRWLNQEYGFALEIDNSAGPLTWTALRKALQMEINRQGGAGLEIDGSIGPKTKAAIIYTKRGTKGNITKLVQAALYCKGYDPNGLDGGFGPGTEAAVRKYQADHGLTVDGMAGRETQVSLFRV
Other Proteins in cluster: phalp2_17898
| Total (incl. this protein): 130 | Avg length: 288,5 | Avg pI: 8,49 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| EGF4 | 304 | 8,20600 |
| 10DhW | 236 | 8,67121 |
| 11wHP | 271 | 9,08561 |
| 14xtl | 235 | 9,39667 |
| 1a2Cf | 299 | 9,20578 |
| 1dk8v | 298 | 9,60832 |
| 1k3fX | 272 | 5,48311 |
| 1mq4s | 327 | 8,44776 |
| 1n3pN | 357 | 5,92816 |
| 23hH6 | 283 | 9,27611 |
| 2Pqr7 | 282 | 8,93669 |
| 2c4jl | 224 | 8,05321 |
| 2mx3K | 359 | 8,23366 |
| 3ITVB | 283 | 8,88376 |
| 3PPLV | 257 | 5,10621 |
| 3ix0K | 285 | 9,47655 |
| 3jMyE | 253 | 8,95203 |
| 3kLOW | 254 | 9,45063 |
| 3kYbu | 345 | 6,93489 |
| 3kj8y | 240 | 9,35528 |
| 3lE2C | 264 | 8,55749 |
| 3lRAS | 312 | 9,57357 |
| 3nI6v | 255 | 9,27682 |
| 3qqcN | 357 | 5,92816 |
| 3qxw0 | 254 | 9,34387 |
| 3tfdX | 282 | 8,86023 |
| 3uGgX | 327 | 8,58585 |
| 3ugwn | 254 | 9,38216 |
| 3uwTZ | 254 | 9,39351 |
| 3x8P4 | 312 | 9,53728 |
| 3xWgT | 319 | 8,92753 |
| 3yOPr | 283 | 8,76572 |
| 41jMv | 236 | 9,65306 |
| 4j9MP | 344 | 10,08068 |
| 4lMLO | 221 | 6,29909 |
| 4xpjB | 301 | 6,63870 |
| 5LAxi | 361 | 8,71227 |
| 5MU3C | 357 | 5,61384 |
| 5Pu1T | 319 | 9,00083 |
| 5X20B | 345 | 6,33575 |
| 5Y5w5 | 361 | 5,19340 |
| 5hTQ8 | 310 | 8,40979 |
| 5imOE | 261 | 6,12226 |
| 5iquw | 305 | 9,24349 |
| 603kN | 328 | 8,44286 |
| 60oqv | 283 | 8,75798 |
| 64tnX | 271 | 9,08548 |
| 691TB | 258 | 8,73471 |
| 6M0xE | 227 | 6,20053 |
| 6bVFK | 331 | 9,62205 |
| 6dWoE | 304 | 8,85082 |
| 6eUsg | 359 | 5,39006 |
| 6fyz0 | 283 | 8,60584 |
| 6icfF | 332 | 8,45182 |
| 6kGQ4 | 312 | 9,40344 |
| 6kIJI | 327 | 9,11075 |
| 6nVif | 345 | 6,97877 |
| 6ntHT | 272 | 9,91396 |
| 6nu13 | 253 | 8,90910 |
| 6pm3 | 236 | 9,12990 |
| 6q7n | 280 | 8,57289 |
| 6qIzQ | 351 | 8,97550 |
| 6rY17 | 353 | 9,17748 |
| 6u5wK | 357 | 5,92810 |
| 72zEl | 332 | 8,84991 |
| 76Nna | 356 | 6,17603 |
| 7ATcr | 301 | 9,85994 |
| 7BKUS | 300 | 9,17142 |
| 7BdIt | 234 | 8,70989 |
| 7Bmmg | 224 | 9,36379 |
| 7BmoO | 304 | 9,01624 |
| 7M4u9 | 271 | 8,86500 |
| 7MlR6 | 271 | 9,08555 |
| 7OgGM | 282 | 8,74399 |
| 7Ukzv | 282 | 8,40334 |
| 7YgdX | 253 | 7,03697 |
| 7Z6c5 | 292 | 9,60252 |
| 7ZA4w | 271 | 8,72240 |
| 7bg6E | 240 | 9,04590 |
| 7cfRz | 306 | 8,77481 |
| 7fnNv | 234 | 8,94307 |
| 7gepF | 304 | 8,94127 |
| 7htOn | 272 | 9,21919 |
| 7lBwq | 322 | 9,71888 |
| 7pFbd | 259 | 7,65135 |
| 7po7q | 258 | 8,56761 |
| 7qSZ3 | 235 | 9,15917 |
| 7qTuQ | 288 | 9,19450 |
| 7rPqA | 295 | 9,57499 |
| 7su15 | 314 | 8,54627 |
| 7su2N | 317 | 8,30703 |
| 7uyhy | 299 | 9,05802 |
| 7vDbl | 254 | 9,26818 |
| 7vdyG | 299 | 8,68262 |
| 7vzgc | 249 | 7,73109 |
| 7wMj4 | 272 | 9,41685 |
| 7wfCi | 368 | 9,53960 |
| 7xzN5 | 212 | 8,73026 |
| 7yZoD | 329 | 9,29926 |
| 7yZqC | 330 | 8,69706 |
| 82oSS | 295 | 9,34909 |
| 82t4W | 264 | 8,35609 |
| 83ZnT | 354 | 9,35509 |
| 844E | 284 | 9,38964 |
| 84dJh | 328 | 8,71788 |
| 85X8I | 247 | 8,10879 |
| 88ezV | 206 | 7,03959 |
| 8K7va | 309 | 9,28869 |
| 8aVaA | 253 | 9,04609 |
| 8cFiQ | 252 | 8,45575 |
| 8ezJw | 252 | 8,83025 |
| 8hjzt | 266 | 9,09644 |
| 8idaU | 361 | 8,77133 |
| 8ku0I | 332 | 8,24507 |
| 8lqGy | 351 | 9,00348 |
| 8pmoz | 253 | 8,94301 |
| 8s7Yt | 315 | 8,77010 |
| 9vgd | 262 | 8,61460 |
| K0FM | 327 | 8,26145 |
| d1Cx | 237 | 8,13773 |
| m15K | 268 | 8,79621 |
| n2ba | 240 | 6,29721 |
| ocji | 247 | 8,35931 |
| ogV8 | 245 | 6,73794 |
| op7C | 251 | 5,53796 |
| p4JG | 271 | 8,97975 |
| wTD6 | 271 | 8,36395 |
| xnkF | 271 | 8,71582 |
| A0A8S5SWU1 | 332 | 8,85507 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36746
6AI9B
|
16 | 35,7% | 322 | 2.376E-88 |
| 2 |
phalp2_24835
7sl6i
|
39 | 34,4% | 337 | 3.821E-69 |
| 3 |
phalp2_24299
3nIle
|
36 | 44,2% | 190 | 3.061E-67 |
| 4 |
phalp2_5925
64hKp
|
120 | 30,0% | 313 | 1.897E-60 |
| 5 |
phalp2_6450
8Jtqs
|
137 | 37,7% | 302 | 6.622E-60 |
| 6 |
phalp2_29544
3KzTO
|
225 | 39,2% | 242 | 1.629E-56 |
| 7 |
phalp2_26224
op4C
|
2 | 25,0% | 360 | 1.977E-55 |
| 8 |
phalp2_32877
3ejEW
|
46 | 27,2% | 334 | 2.128E-53 |
| 9 |
phalp2_36521
1qwup
|
277 | 29,4% | 285 | 4.254E-51 |
| 10 |
phalp2_38692
MSLD
|
8 | 29,6% | 314 | 2.756E-50 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(EGF4)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50