Protein
- Protein accession
- 81VgJ [EnVhog]
- Representative
- 4nryL
- Source
- EnVhog (cluster: phalp2_4622)
- Protein name
- 81VgJ
- Lysin probability
- 82%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MRRITATIVTTLTLLIGIGTAHAAQAPQPTHSTSVTRTQVIPKEPQPTIVFRHGDISWLPQLAAEAGWPPKTWKRLGQIILRESGGCPNRRGGDIVNKNCEVIGHDGSNHRSDTSLLQINGVNYDPKRNKYAPICTEMKICTQEPLLDALTNLKAGLLLFRVTGSDWSPWIVPEGGW
- Physico‐chemical
properties -
protein length: 177 AA molecular weight: 19464,1 Da isoelectric point: 9,23 hydropathy: -0,30
Representative Protein Details
- Accession
- 4nryL
- Protein name
- 4nryL
- Sequence length
- 177 AA
- Molecular weight
- 19912,65800 Da
- Isoelectric point
- 9,06911
- Sequence
-
MRIFTRLTAALTVGLIAFGSIVYAAEAPANPPFQTYTPLREGPIASERRLETPIVFRHGDISWLPQLAAQAGWPERTWKRLGHIILRESGGCPNRRGGDAVNKFCEITHVTEWNHRSDTGLLQLNGVHWKQDHPQYAGLICKQMGICTQEPLLDPLTNLQAGLLLWQVAGWQPWKRS
Other Proteins in cluster: phalp2_4622
| Total (incl. this protein): 166 | Avg length: 181,5 | Avg pI: 8,71 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4nryL | 177 | 9,06911 |
| 12YCX | 175 | 9,47448 |
| 17VJy | 177 | 8,98136 |
| 18F1U | 177 | 8,78506 |
| 18Kwa | 183 | 8,22360 |
| 18oJJ | 156 | 8,76533 |
| 19E8d | 173 | 9,29720 |
| 19HMv | 175 | 9,33420 |
| 19Nn4 | 177 | 9,55023 |
| 19SL2 | 162 | 8,43467 |
| 19VMW | 187 | 8,24726 |
| 1DIFs | 188 | 9,16794 |
| 1JJkh | 183 | 8,88131 |
| 1JUU9 | 187 | 8,25474 |
| 1JoBU | 173 | 9,20978 |
| 1JtIG | 177 | 9,47365 |
| 1NOLt | 173 | 9,20668 |
| 1OBuU | 188 | 8,89704 |
| 1h5bG | 190 | 8,77932 |
| 1iyS4 | 169 | 6,95223 |
| 1jvdw | 195 | 8,58720 |
| 1y8GY | 177 | 9,00109 |
| 1ydAm | 183 | 8,88131 |
| 1zcP4 | 183 | 8,71337 |
| 1zl0S | 184 | 7,70614 |
| 20wvT | 189 | 9,27734 |
| 21cKs | 187 | 8,58353 |
| 27OAS | 258 | 9,84034 |
| 27xxi | 173 | 9,38500 |
| 2RSQu | 177 | 9,38436 |
| 2W0yQ | 188 | 9,05402 |
| 2WYbT | 190 | 8,24733 |
| 2XCZg | 184 | 8,55877 |
| 2XXGC | 218 | 8,83238 |
| 2YeJi | 185 | 7,69068 |
| 2iIKu | 179 | 7,59206 |
| 2jawi | 187 | 8,56748 |
| 2ln8j | 230 | 9,78019 |
| 30MG3 | 177 | 9,04454 |
| 30pIG | 228 | 9,70960 |
| 30qg9 | 228 | 9,72971 |
| 30rkD | 256 | 9,24459 |
| 31IpR | 187 | 6,80609 |
| 31Osa | 174 | 8,83496 |
| 31vyd | 177 | 9,45682 |
| 31w79 | 187 | 6,40367 |
| 32VFV | 187 | 8,80859 |
| 33zxY | 183 | 9,02082 |
| 35ajl | 181 | 9,50749 |
| 37gd1 | 184 | 7,68176 |
| 37qG6 | 173 | 7,68789 |
| 37zk7 | 178 | 9,45908 |
| 38kWr | 186 | 8,80253 |
| 38pYc | 183 | 8,94249 |
| 3XRGG | 181 | 6,51030 |
| 3bnGi | 180 | 9,02179 |
| 46uAZ | 173 | 9,13132 |
| 47B1W | 198 | 9,16626 |
| 49Ews | 161 | 9,41962 |
| 49IgJ | 175 | 9,18199 |
| 49Wxa | 176 | 9,54649 |
| 49es3 | 177 | 8,78061 |
| 49wK0 | 173 | 8,98510 |
| 49wuc | 178 | 8,76346 |
| 4AucR | 179 | 8,39954 |
| 4DO4p | 220 | 9,48725 |
| 4GEIO | 177 | 9,58530 |
| 4NHBo | 181 | 8,97079 |
| 4NJ5r | 178 | 8,79679 |
| 4Or0g | 173 | 9,35618 |
| 4aAbI | 181 | 8,51094 |
| 4au4I | 184 | 8,13773 |
| 4bNho | 173 | 6,72049 |
| 4h4Eg | 190 | 8,24249 |
| 4kFKo | 179 | 9,23859 |
| 4lWWn | 196 | 8,53795 |
| 4m5Q3 | 178 | 8,22122 |
| 4mMNj | 167 | 9,03881 |
| 4nDYP | 224 | 9,03687 |
| 4qJUM | 173 | 9,35612 |
| 4qbRL | 193 | 8,92083 |
| 4rAH2 | 179 | 8,75095 |
| 4rk6w | 184 | 8,77326 |
| 4s9a1 | 174 | 9,50581 |
| 4wua4 | 200 | 9,13654 |
| 4zRFs | 178 | 8,79731 |
| 50U2r | 173 | 9,54649 |
| 52moX | 187 | 8,22573 |
| 54tfa | 140 | 8,41366 |
| 56DTS | 177 | 9,32575 |
| 56IIU | 187 | 7,60110 |
| 56NOO | 162 | 8,74754 |
| 57CLU | 176 | 8,18898 |
| 57UjP | 198 | 8,74148 |
| 58TxL | 173 | 8,55368 |
| 59pbF | 162 | 7,71131 |
| 59wvp | 179 | 7,58320 |
| 5Bv0V | 178 | 8,73400 |
| 5DrYL | 179 | 8,41050 |
| 5a7KN | 187 | 7,60053 |
| 5a98b | 162 | 5,59037 |
| 5aGzJ | 214 | 9,64468 |
| 5aePl | 177 | 8,78061 |
| 5bLTN | 184 | 9,09715 |
| 5cYzN | 190 | 8,55852 |
| 5ckqu | 175 | 9,91906 |
| 5cmhX | 173 | 9,18470 |
| 5dmuH | 180 | 7,66630 |
| 5eF55 | 175 | 9,80869 |
| 5f3SH | 177 | 9,23415 |
| 5fiZ2 | 179 | 8,62711 |
| 5fvRT | 177 | 8,78061 |
| 5gkok | 162 | 8,42565 |
| 5hucj | 173 | 9,32756 |
| 5iGkh | 179 | 7,58820 |
| 5kRXP | 173 | 5,18573 |
| 5mgwe | 191 | 6,87942 |
| 5ntMU | 179 | 8,10079 |
| 5thLV | 187 | 8,58289 |
| 5uMQD | 173 | 9,35618 |
| 5z6sb | 177 | 9,50066 |
| 6KwKe | 180 | 7,62872 |
| 6MfGb | 172 | 8,80962 |
| 6Mrxo | 140 | 8,41005 |
| 6SVTD | 173 | 9,00090 |
| 6xMKZ | 140 | 9,00135 |
| 6yeLr | 175 | 9,60954 |
| 6z6BV | 174 | 8,79757 |
| 7KanA | 218 | 8,65993 |
| 7Xajo | 177 | 9,20765 |
| 7Y2l | 190 | 9,11552 |
| 81TJo | 173 | 6,72692 |
| 81Ute | 177 | 9,50066 |
| 82RAK | 187 | 8,59307 |
| 8E5B8 | 184 | 8,89311 |
| 8FVRj | 177 | 9,64681 |
| 8bF2V | 174 | 9,20771 |
| 8bm1Y | 187 | 7,61969 |
| 8dZkr | 179 | 8,75095 |
| 8e914 | 220 | 9,50536 |
| 8npSp | 190 | 8,58289 |
| 8nwNx | 187 | 8,82148 |
| 8oS8a | 177 | 9,18186 |
| 8ohao | 177 | 9,38442 |
| 8rvtP | 177 | 9,50066 |
| 8t4rc | 169 | 8,74883 |
| 8y3YA | 184 | 9,97244 |
| AdH6 | 137 | 8,96370 |
| C9xw | 182 | 8,72014 |
| CfSJ | 187 | 7,61326 |
| ChdX | 180 | 8,23282 |
| EvoT | 187 | 8,25468 |
| H5FB | 190 | 8,76836 |
| RXuZ | 181 | 8,88099 |
| SOqV | 181 | 8,70389 |
| ST6I | 173 | 8,77984 |
| SwXT | 179 | 9,11378 |
| Ue78 | 177 | 8,76436 |
| Ugtm | 179 | 6,92938 |
| X8vf | 173 | 9,72823 |
| dShX | 173 | 9,99094 |
| iTF9 | 164 | 8,94500 |
| qyLm | 170 | 7,70642 |
| zS4n | 178 | 9,63430 |
| A0A1B0XUK8 | 180 | 7,69551 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_40522
4GjG8
|
210 | 72,9% | 122 | 2.068E-72 |
| 2 |
phalp2_24419
4oWdT
|
7 | 73,8% | 111 | 8.790E-64 |
| 3 |
phalp2_8459
165nm
|
626 | 32,8% | 125 | 3.326E-13 |
| 4 |
phalp2_26521
7XVtu
|
369 | 25,4% | 185 | 7.271E-12 |
| 5 |
phalp2_3718
5j50L
|
31 | 34,8% | 132 | 1.346E-11 |
| 6 |
phalp2_3862
6IDp9
|
274 | 24,1% | 178 | 4.605E-11 |
| 7 |
phalp2_8391
CgjB
|
207 | 28,9% | 114 | 6.262E-11 |
| 8 |
phalp2_27902
jLnT
|
10 | 29,8% | 114 | 2.905E-10 |
| 9 |
phalp2_33775
1865r
|
7 | 32,2% | 121 | 4.563E-09 |
| 10 |
phalp2_34455
4DPBl
|
20 | 25,0% | 144 | 4.563E-09 |
Domains
Domains
1
177 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4nryL)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50