Protein
- Protein accession
- 7uORE [EnVhog]
- Representative
- 7ubMN
- Source
- EnVhog (cluster: phalp2_15061)
- Protein name
- 7uORE
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
LGKAADVIRIARGEIGYREGYSGGHWNNHQRYSPAVPGLEWSQNQAWCATFVSWCARQAGGASLFPVTASVWTAYDWFKSRGRYSAYPAIGAQVIYGRSANSHTGIVVAYDSTYITTVEGNTNANGSAEGDGVYLKRRRRRDAYVHGYGLPRYAEGVTTADPALKGKAGFTYKATASGPTTGGSHTGSSKAKTVTVKAGQTLGKIAASAGVSLAALLAINPQIKNPDLIHPGDKISIPDKGAKPPAKSKPVVSLARIRAAAVRDPDLRQGGTTYPADVRHVEAALKAEGLLDGRWCDGSFGSMTRIAYANWQKRARVGGPPDGIPGIASLRLLGTKHGFTVKG
- Physico‐chemical
properties -
protein length: 343 AA molecular weight: 36270,5 Da isoelectric point: 9,96 hydropathy: -0,34
Representative Protein Details
- Accession
- 7ubMN
- Protein name
- 7ubMN
- Sequence length
- 276 AA
- Molecular weight
- 28937,14240 Da
- Isoelectric point
- 5,08745
- Sequence
-
MSGASAIINSAEAEVGYHEGRDSDGNWNNIQKYSEQVPGLAWSDGEAWCATFMSWLAMVSGNAALYPRTASCAEGVDWFRSIGRFSEYPAVGAQAFYGPGGGSHTGLVVRFDDTHIYTVEGNTNDNGSAQGDGVYRQTRRRRDDYVYGYGYPRFAEGIVSADPAYGGKSSGGSTPTPAPKPVVSLSNVVAAAETDPGASQGHQTHAADVRLVEAALHAEGLLSATYASDGSYGSSTITAYAEWQRKLGYSGSDADGIPGMTSLSKLGASHGFSVKA
Other Proteins in cluster: phalp2_15061
| Total (incl. this protein): 176 | Avg length: 288,5 | Avg pI: 8,31 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7ubMN | 276 | 5,08745 |
| 136a | 280 | 9,66415 |
| 139N | 280 | 9,61283 |
| 1fPBE | 259 | 4,73693 |
| 1fR3Y | 274 | 9,03545 |
| 1fRDD | 257 | 9,94491 |
| 2Vor3 | 271 | 8,11059 |
| 3LzON | 337 | 9,45385 |
| 3PsIb | 274 | 7,87786 |
| 3bZ3y | 238 | 9,64913 |
| 3e60I | 284 | 6,96593 |
| 3eamU | 278 | 9,71140 |
| 3ezQy | 333 | 9,34219 |
| 3nAy | 295 | 10,06553 |
| 4EDVr | 295 | 5,88559 |
| 4Es8X | 274 | 9,67743 |
| 4F8YT | 279 | 5,55439 |
| 4HGAt | 283 | 8,84669 |
| 4HUZQ | 283 | 6,03314 |
| 4ToUt | 265 | 5,51215 |
| 5F0u3 | 257 | 8,46168 |
| 5innW | 369 | 9,07407 |
| 5iqrq | 334 | 9,56577 |
| 5nMT4 | 250 | 5,06040 |
| 5nOlP | 278 | 8,98149 |
| 5y9WP | 271 | 6,19502 |
| 5yb9b | 261 | 6,59829 |
| 6CE1W | 489 | 9,74886 |
| 6CGBl | 296 | 8,59636 |
| 6CHbK | 282 | 9,39635 |
| 6CIqm | 277 | 9,25594 |
| 6CLXg | 283 | 6,29540 |
| 6CxFv | 461 | 9,09670 |
| 6D3zH | 284 | 6,14136 |
| 6DChx | 281 | 9,56725 |
| 6DJyC | 283 | 6,49331 |
| 6DQcY | 212 | 4,70129 |
| 6DQjs | 278 | 9,44799 |
| 6DVHl | 278 | 9,40080 |
| 6DXja | 287 | 9,43380 |
| 6DdP3 | 364 | 8,55329 |
| 6Df7H | 465 | 9,12681 |
| 6DfRa | 290 | 9,05118 |
| 6Dg8H | 281 | 9,58047 |
| 6DkJJ | 282 | 9,54263 |
| 6Dkjf | 295 | 9,69013 |
| 6DlZa | 288 | 6,35411 |
| 6DnVe | 280 | 9,71373 |
| 6DoDD | 284 | 6,38009 |
| 6DsM9 | 276 | 9,34252 |
| 6DxcM | 280 | 9,70567 |
| 6E0zM | 209 | 5,84256 |
| 6E2a8 | 287 | 9,67208 |
| 6EBRm | 280 | 9,66415 |
| 6ECNm | 277 | 9,40080 |
| 6ED1J | 288 | 6,35400 |
| 6EDhN | 297 | 9,56545 |
| 6EFLT | 284 | 5,93055 |
| 6EJQS | 274 | 9,70522 |
| 6ELRM | 287 | 9,49879 |
| 6ER29 | 461 | 9,04203 |
| 6ERF9 | 288 | 6,35411 |
| 6ERgV | 290 | 8,31760 |
| 6EZQG | 480 | 9,42446 |
| 6ErIm | 298 | 9,78896 |
| 6EsiM | 273 | 9,40686 |
| 6Eu4F | 277 | 9,40080 |
| 6EuVz | 199 | 8,95345 |
| 6F4li | 283 | 9,48564 |
| 6F6N1 | 282 | 9,31009 |
| 6F89s | 276 | 5,29236 |
| 6Fcz0 | 291 | 8,79853 |
| 6FoKw | 288 | 9,34716 |
| 6FrbO | 278 | 9,35103 |
| 6GFjD | 290 | 9,67324 |
| 6H3KE | 287 | 7,17799 |
| 6H3Yk | 290 | 8,93417 |
| 6IVVC | 267 | 9,45908 |
| 6IXO1 | 276 | 5,29236 |
| 6J6z9 | 278 | 9,44799 |
| 6J8IZ | 281 | 9,62405 |
| 6KJ4Y | 295 | 9,76272 |
| 6KJbM | 292 | 9,46842 |
| 6KOp7 | 265 | 5,50039 |
| 6KlYU | 265 | 4,73210 |
| 6Kpxw | 278 | 9,35103 |
| 6KrUN | 284 | 5,98398 |
| 6KsBI | 255 | 5,31850 |
| 6OcWs | 265 | 5,50039 |
| 6Od5c | 290 | 9,73739 |
| 6OfBA | 278 | 9,44799 |
| 6T7Et | 299 | 9,40479 |
| 6TaS2 | 281 | 9,37984 |
| 6Vb0n | 281 | 9,53180 |
| 6VbE9 | 265 | 6,30557 |
| 6VbsB | 267 | 9,84621 |
| 6W4TY | 244 | 8,51494 |
| 6Xcpp | 260 | 5,97141 |
| 726c1 | 261 | 9,60026 |
| 726dJ | 272 | 9,78432 |
| 7277h | 268 | 9,49911 |
| 72qIh | 263 | 5,71382 |
| 753WD | 343 | 9,84099 |
| 7582w | 280 | 9,46584 |
| 792fX | 343 | 9,97347 |
| 7ANBg | 363 | 9,24762 |
| 7B89K | 278 | 9,42710 |
| 7BG4O | 276 | 9,34909 |
| 7QlL0 | 368 | 9,32569 |
| 7bxWt | 343 | 9,65815 |
| 7df7W | 351 | 9,72713 |
| 7ekdA | 275 | 9,92421 |
| 7gCSH | 227 | 9,22783 |
| 7i5Lm | 278 | 9,82139 |
| 7lD3i | 283 | 9,74744 |
| 7m75V | 265 | 5,69279 |
| 7mzyn | 276 | 9,37649 |
| 7o6YS | 270 | 8,91432 |
| 7o7MW | 278 | 7,77349 |
| 7orU8 | 253 | 9,30003 |
| 7ouVe | 279 | 9,35238 |
| 7p72z | 275 | 9,34671 |
| 7rdgg | 323 | 9,26309 |
| 7tMwb | 282 | 4,65548 |
| 7uPHa | 269 | 8,95519 |
| 7uPOC | 334 | 9,31048 |
| 7uPlZ | 278 | 4,76410 |
| 7ubS0 | 329 | 4,61529 |
| 7uc5v | 343 | 9,87689 |
| 7ucFM | 204 | 4,85225 |
| 7ucxz | 357 | 9,33620 |
| 7xLXI | 264 | 9,58621 |
| 7y7Bb | 334 | 9,98101 |
| 7y7Ej | 255 | 9,22525 |
| 7ye1e | 265 | 4,66753 |
| 7zGus | 267 | 9,38939 |
| 7zgCU | 279 | 4,84037 |
| 7zgPZ | 274 | 6,13949 |
| 7zgr0 | 285 | 9,56119 |
| 7zhfr | 344 | 9,72314 |
| 7ziAT | 284 | 4,60108 |
| 7ziFQ | 265 | 6,18388 |
| 7zik3 | 274 | 5,70751 |
| 7zizC | 265 | 5,09047 |
| 7zjUi | 267 | 9,55977 |
| 7zjqu | 280 | 9,58343 |
| 7zk9s | 278 | 5,95891 |
| 7zkAS | 346 | 9,62947 |
| 7zklS | 265 | 5,68239 |
| 7zko9 | 265 | 5,23955 |
| 7zmk0 | 253 | 9,47751 |
| 8Jj0a | 284 | 9,81488 |
| 8Jj0b | 280 | 9,24433 |
| 8Jj0c | 284 | 9,38004 |
| 8Jj0h | 290 | 9,72565 |
| 8MGQZ | 275 | 9,38216 |
| 8MGRR | 273 | 9,32163 |
| 8MHs6 | 282 | 9,40576 |
| 8MKdU | 370 | 9,17425 |
| 8MKtm | 288 | 9,60174 |
| 8MOMj | 279 | 9,18051 |
| 8MP1G | 283 | 9,54353 |
| 8MWxO | 276 | 9,38326 |
| 8MwPV | 285 | 9,75744 |
| 8Mx43 | 286 | 9,54856 |
| 8eGbW | 289 | 9,65113 |
| 8j2MA | 267 | 10,19389 |
| PgA | 264 | 8,35428 |
| QPGa | 277 | 9,81533 |
| bqub | 265 | 5,50050 |
| bu48 | 201 | 4,77961 |
| ckq | 264 | 4,85157 |
| A0A2P1N0I7 | 305 | 6,11874 |
| A0A7H0XAU4 | 305 | 6,59585 |
| A0AA50F1Y0 | 276 | 9,70380 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_20992
7zazP
|
46 | 61,0% | 172 | 5.494E-83 |
| 2 |
phalp2_28359
1gpKu
|
9 | 30,3% | 264 | 2.335E-49 |
| 3 |
phalp2_24284
3fAJx
|
9 | 32,5% | 280 | 3.057E-46 |
| 4 |
phalp2_8114
6H1JM
|
136 | 33,6% | 276 | 1.454E-45 |
| 5 |
phalp2_1959
4y5vj
|
188 | 28,8% | 281 | 8.747E-37 |
| 6 |
phalp2_13865
7ucym
|
2 | 27,0% | 285 | 4.916E-35 |
| 7 |
phalp2_1568
7XJtL
|
188 | 27,8% | 287 | 1.245E-34 |
| 8 |
phalp2_14320
3VFlX
|
143 | 27,1% | 276 | 5.849E-34 |
| 9 |
phalp2_29160
7s0gR
|
24 | 27,9% | 293 | 2.746E-33 |
| 10 |
phalp2_40071
41qFE
|
139 | 25,5% | 274 | 1.288E-32 |
Domains
Domains
1
276 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7ubMN)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50