Protein
- Protein accession
- 7uLYr [EnVhog]
- Representative
- 4VDTp
- Source
- EnVhog (cluster: phalp2_39458)
- Protein name
- 7uLYr
- Lysin probability
- 97%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MNGIDVSNHNGSIDFNKVKEDNIEVVYIKATEGTTYKDPYLNQHYSGAKKAGLKTGFYHFLVGSSEPETQAENFYNNIKDKENDLKPCLDIETNNFNVMDYALRFIKKFECLCELELCIYTSPYFANENLDSRLAKYQCWIAHYGVETPMETNVWRDNYAGHQFTETGRINGINTNVDINTFTKDIFTNNKSQGYVVTQYLPNGYRGDNSFEGIDLEYVLSYFKDVRCYVRKDSKGVWIETQTLSMGKCLELKKVLGSWFYSIEIK
- Physico‐chemical
properties -
protein length: 266 AA molecular weight: 30777,2 Da isoelectric point: 5,36 hydropathy: -0,55
Representative Protein Details
- Accession
- 4VDTp
- Protein name
- 4VDTp
- Sequence length
- 308 AA
- Molecular weight
- 34484,45630 Da
- Isoelectric point
- 5,79385
- Sequence
-
MKGIDISNHNGRIDWNKLKNSDVNLVYIKASEGTTYQDPYLNEHYQGAKAIGLPTGFYHYLKGTSAPESQALNFWSLIKDKENNLIPCLDIEENGFNVMDYALRFISKFKELSNLPILIYTGPYFANDNLDNRLASYPCWIAHYGVSSPMATNTWGTNYVGHQYTEKGSVPGINGNVDLNNFTEGILIKGDIENIVVNNNVNDVEDLGGNDIYSILQRELNKQGFRDKNGNKLKVDGRPGELTLSACPLVKKGAKGEITRWIQLRVGANPDTDFGQETENCVIWMQNKWGITPDGIVGKNTWKKLLGL
Other Proteins in cluster: phalp2_39458
| Total (incl. this protein): 155 | Avg length: 302,5 | Avg pI: 6,51 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4VDTp | 308 | 5,79385 |
| 14kIh | 258 | 8,48915 |
| 1GWen | 269 | 7,81810 |
| 1Ky6y | 245 | 4,67139 |
| 1kYTP | 319 | 8,74606 |
| 1lVZG | 344 | 6,25010 |
| 1lYru | 307 | 5,71035 |
| 1r69I | 377 | 6,33098 |
| 2A2ju | 304 | 6,95649 |
| 2b9Z5 | 305 | 8,80176 |
| 2b9ge | 301 | 8,99220 |
| 2ba42 | 300 | 5,96948 |
| 2lYBf | 326 | 8,33062 |
| 2mvSB | 291 | 5,00828 |
| 2mvj8 | 261 | 4,67008 |
| 2mwvd | 330 | 4,92114 |
| 3AhRg | 276 | 5,55336 |
| 3Akdp | 314 | 4,61211 |
| 3If8h | 298 | 8,82600 |
| 3Nz91 | 284 | 8,28659 |
| 3P8zg | 310 | 4,36435 |
| 3QyKt | 310 | 6,08685 |
| 3fxe0 | 307 | 4,10289 |
| 3uGdZ | 298 | 8,91812 |
| 3uo4W | 301 | 6,89340 |
| 4SFNd | 277 | 8,76978 |
| 4UzYl | 315 | 8,70931 |
| 4l1vP | 332 | 6,00307 |
| 4lwdD | 201 | 4,86254 |
| 4pK | 307 | 6,30637 |
| 5Ms7L | 305 | 8,43390 |
| 5O2pr | 292 | 5,16112 |
| 5R46y | 353 | 8,93759 |
| 5VpFh | 298 | 8,38806 |
| 5hRow | 316 | 5,44440 |
| 5hScP | 263 | 4,72601 |
| 5hVA8 | 312 | 7,66254 |
| 5hY59 | 305 | 4,67088 |
| 5hYRU | 309 | 4,54606 |
| 5inZ8 | 305 | 4,47672 |
| 62074 | 297 | 8,08687 |
| 66XTr | 300 | 8,58791 |
| 6Pu86 | 337 | 5,34897 |
| 6PugB | 317 | 4,62740 |
| 6WEPN | 263 | 5,71973 |
| 6WFdJ | 366 | 6,15796 |
| 6Wvcv | 315 | 5,01078 |
| 6l8xv | 298 | 8,57031 |
| 6p57P | 297 | 8,38258 |
| 71QZ3 | 319 | 5,67290 |
| 71QZQ | 317 | 5,62384 |
| 71R1O | 321 | 5,60702 |
| 71R1T | 279 | 5,27906 |
| 71R37 | 283 | 5,07273 |
| 71S11 | 344 | 6,39521 |
| 72927 | 262 | 4,78757 |
| 72vFw | 291 | 8,88614 |
| 75LFt | 261 | 4,78757 |
| 75zzQ | 264 | 5,28633 |
| 76kXE | 261 | 4,84390 |
| 76l0w | 261 | 4,61916 |
| 797SK | 340 | 8,52725 |
| 79K8Y | 318 | 5,29082 |
| 79K9V | 267 | 4,97872 |
| 79KaT | 318 | 5,14793 |
| 79KjG | 344 | 6,18177 |
| 79q6T | 268 | 8,35512 |
| 7C2L0 | 340 | 8,70918 |
| 7RsMF | 344 | 8,84927 |
| 7YQZ | 414 | 6,32285 |
| 7bQhX | 263 | 4,93626 |
| 7bQjQ | 261 | 4,71419 |
| 7bQl2 | 261 | 4,93626 |
| 7bd2t | 264 | 5,27815 |
| 7bd3q | 264 | 5,45009 |
| 7cW6m | 331 | 5,47220 |
| 7czXe | 355 | 9,09683 |
| 7deEW | 344 | 8,53847 |
| 7deHr | 339 | 7,59047 |
| 7dkSh | 307 | 5,98545 |
| 7e6Bg | 340 | 8,47800 |
| 7eQDt | 264 | 5,57672 |
| 7eUE3 | 277 | 8,94114 |
| 7efhI | 264 | 6,45750 |
| 7gAcD | 344 | 9,05711 |
| 7gAcx | 340 | 7,02640 |
| 7gDz2 | 366 | 5,67778 |
| 7gIt9 | 280 | 9,15337 |
| 7h4sV | 340 | 8,52718 |
| 7hBxP | 261 | 4,72601 |
| 7hey3 | 261 | 4,60580 |
| 7hfql | 261 | 4,61916 |
| 7hfrc | 262 | 4,79973 |
| 7iYt9 | 341 | 8,64226 |
| 7jj58 | 309 | 4,52571 |
| 7jjBh | 327 | 5,14179 |
| 7jjC8 | 333 | 5,44020 |
| 7jjJ8 | 327 | 4,92842 |
| 7jjnb | 261 | 4,71340 |
| 7kjTf | 341 | 8,83264 |
| 7kkBw | 267 | 5,26417 |
| 7kkbu | 339 | 8,82580 |
| 7kkmR | 345 | 9,05770 |
| 7kkvt | 381 | 8,80711 |
| 7kkxL | 345 | 8,72820 |
| 7lEce | 368 | 6,11135 |
| 7llEI | 264 | 5,52602 |
| 7llFx | 264 | 5,59861 |
| 7lnDr | 344 | 9,07916 |
| 7lnGm | 355 | 8,78519 |
| 7lnoe | 344 | 8,70338 |
| 7m5wR | 295 | 4,52486 |
| 7m9ob | 261 | 4,77518 |
| 7ojqu | 261 | 4,85174 |
| 7p4Bh | 261 | 4,79973 |
| 7p6Y6 | 261 | 4,77518 |
| 7tqHj | 261 | 4,74994 |
| 7tqQU | 261 | 4,89147 |
| 7tquh | 261 | 4,85743 |
| 7tqwq | 261 | 4,78757 |
| 7trBm | 261 | 4,71737 |
| 7trt7 | 262 | 4,86874 |
| 7tsQg | 262 | 4,75006 |
| 7tsTl | 261 | 4,73818 |
| 7txEj | 261 | 4,68384 |
| 7tzln | 262 | 4,78757 |
| 7u24m | 261 | 4,79973 |
| 7u28A | 340 | 8,99677 |
| 7u2ck | 340 | 8,88408 |
| 7uLKs | 340 | 7,68431 |
| 7uLN7 | 344 | 8,44666 |
| 7uLYQ | 264 | 5,40746 |
| 7uyoL | 380 | 8,25616 |
| 7v532 | 261 | 4,58403 |
| 7v53W | 259 | 4,59540 |
| 7v58B | 261 | 4,79973 |
| 7vFI6 | 313 | 8,67901 |
| 7vdCa | 344 | 8,49495 |
| 7vdDm | 341 | 8,74431 |
| 7vdMn | 344 | 8,89723 |
| 7wMkX | 319 | 8,88382 |
| 7z5QU | 319 | 8,94230 |
| 82zkH | 300 | 7,55483 |
| 83wvx | 299 | 8,55942 |
| 8581h | 303 | 5,21710 |
| 86YI2 | 324 | 6,52355 |
| 8Kfkm | 302 | 7,01111 |
| 8i62Y | 320 | 6,09674 |
| 8lqq6 | 297 | 8,71453 |
| 8oMRI | 327 | 8,63452 |
| Nvju | 328 | 8,85952 |
| Nvqs | 333 | 8,91838 |
| eIl6 | 307 | 4,47535 |
| wer7 | 261 | 4,80610 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_34303
3xQtT
|
28 | 45,2% | 210 | 1.083E-62 |
| 2 |
phalp2_30706
7cHI2
|
66 | 40,7% | 216 | 1.320E-61 |
| 3 |
phalp2_2537
6a7No
|
192 | 31,4% | 340 | 2.465E-61 |
| 4 |
phalp2_1549
3LwuQ
|
17 | 29,7% | 316 | 1.375E-56 |
| 5 |
phalp2_9283
7cTgF
|
101 | 38,4% | 208 | 3.506E-56 |
| 6 |
phalp2_10644
2AeOK
|
60 | 36,9% | 214 | 6.233E-53 |
| 7 |
phalp2_9994
3h23S
|
34 | 25,3% | 430 | 1.162E-52 |
| 8 |
phalp2_12020
7Olig
|
697 | 26,3% | 322 | 5.805E-45 |
| 9 |
phalp2_34359
474YH
|
38 | 27,3% | 307 | 1.348E-41 |
| 10 |
phalp2_30061
2NCcc
|
23 | 30,2% | 225 | 4.811E-39 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4VDTp)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50