Protein

Protein accession
7tEpO [EnVhog]
Representative
4z1XK
Source
EnVhog (cluster: phalp2_27354)
Protein name
7tEpO
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTSTEQKIAAQILYLEDNRATGPDSLRVTRLPAADKGGDWEICGICDGIEPAVFRHLKSLLDAGKKEEAWEASLQYVLDNTQAVRTWLGAQDCPAVEFFLRDFFFNAGIKSASLAVQRAVNARNGSLKEDSIAGPATRSAFQAALTANGETVMLMLLHRFREQHYRSCKQWGAFGKGWINRLDAAASFAAGLLR
Physico‐chemical
properties
protein length:194 AA
molecular weight:21338,0 Da
isoelectric point:7,68
hydropathy:-0,19
Representative Protein Details
Accession
4z1XK
Protein name
4z1XK
Sequence length
138 AA
Molecular weight
N/A Da
Isoelectric point
6,13880
Sequence
LKALLDAGRREEAWEGCLQYVLDNTAAVRSWLGSDVFPGVEFILRDHYFNSGSRNTGKILQRALNIHGAGLVVDGIVGPRXXXXELQDQLAATGEAVFLIALQEKRQAFYRSCKQFPVFGKGWLNRCDDAFSVAQELV
Other Proteins in cluster: phalp2_27354
Total (incl. this protein): 145 Avg length: 186,4 Avg pI: 7,67

Protein ID Length (AA) pI
4z1XK 138 6,13880
1HqBt 193 6,73817
1kdGy 193 8,30425
1maEG 193 6,73817
1maXf 193 7,61878
1nXrp 193 7,62270
1nbqk 137 6,92341
1ngk5 193 6,31415
1nkTa 193 7,62270
1nlTF 193 9,27237
1nlYY 193 7,63128
1nm8w 193 7,61912
1oi9y 193 8,38851
2X4On 193 7,62719
2X4QS 186 8,33165
2lQ2g 186 7,62594
2lShm 193 8,86622
2mcsR 186 8,30419
3B1Bu 193 7,62679
3B4pe 186 6,14744
3GNew 193 8,30419
3GNlP 186 6,73067
3KMK5 141 7,91486
3KMjg 193 9,13441
3KRzu 193 7,62679
3jUB6 193 8,85191
3kTOK 193 7,62276
3klaD 186 6,73027
3lKLw 194 8,71795
3lndl 186 7,61827
3lzvI 170 9,73584
3mlvf 193 7,62713
3ms2w 186 6,72874
3nvRE 193 7,62310
3p7Hl 193 8,86584
3pFMn 193 7,62719
3pc5a 193 7,61912
3pnQb 186 7,62230
3qAkR 155 6,59084
3qNso 183 9,53566
3qbxT 186 7,62213
3qfAZ 193 6,15654
3quoC 154 6,59084
3r5pb 193 7,61486
3rXSh 193 8,54478
3rfTk 193 9,29687
3rhc0 126 6,13079
3sAe5 193 8,29542
3sipG 186 6,73067
3svsp 186 6,73215
3t8sJ 186 6,14756
3tB4E 193 7,63128
3tHZO 193 8,86622
3tRvx 186 6,73254
3tWn6 193 9,03913
3tcWl 186 6,73175
3tgQF 193 7,63128
3uUS0 193 7,62310
3uYHl 193 7,62315
3uZTF 193 7,61918
3uinE 194 7,68011
3ul81 193 7,62310
3ulMn 186 6,72874
3uqE9 186 7,61423
3uwUF 193 8,63975
3uzNw 193 8,86571
3vBlG 193 7,63128
3vCyS 186 5,74582
3vD6i 193 7,62310
3vE0o 186 8,30406
3vTNb 193 8,83850
3vss1 186 8,29329
3vwZx 193 7,59638
3vx0d 194 8,71782
3vzla 141 7,90042
3w06p 186 7,62594
3wT0C 186 7,62651
3wTgG 193 6,73738
3wgc6 193 7,63066
3whos 193 7,62276
3xqax 193 6,73658
3y2KC 193 8,63027
3y39B 193 8,85172
3y3Eh 194 9,18044
3y7lY 193 6,73777
3yAmq 186 6,14744
3yN8F 193 7,63151
3ya1R 193 7,62719
3yeLz 193 6,15489
3yndH 186 6,73215
3yxQD 193 8,29549
4VDAO 193 7,61912
4VNOf 179 6,18564
4z1Cb 193 7,61912
5KPKR 193 8,65129
5LdHq 193 8,65154
5M3qA 193 7,63128
5P3Wv 186 6,73027
6dcQ3 107 8,04109
6m2q4 186 6,14358
6rDKf 126 8,00950
6uxya 173 7,57723
70TPx 116 8,01943
70UGX 193 7,61912
70X5L 193 8,65142
7Y6W4 193 9,15614
7YRXJ 193 8,54472
7YgJh 193 6,31341
7rWtV 193 7,62674
7s79y 193 7,62270
7sAKO 193 8,28704
7sLFv 193 7,62719
7sLKV 193 7,63975
7sLM7 195 8,85133
7sLUe 161 8,51842
7sOML 193 6,73817
7sONo 193 9,13473
7sOPP 193 7,62679
7sORP 193 7,62230
7sXNq 193 6,73817
7syFD 194 7,68011
7t7Yu 193 8,85172
7tEoI 186 8,86584
7tEsd 193 7,62310
7tEvQ 193 8,86571
7tRrv 193 8,66431
7tRwS 193 8,75102
7tgoo 193 6,73550
7y2ci 193 6,73817
7y2fF 193 6,15597
7y2l3 193 6,15654
85eUh 193 7,62719
86nKH 150 9,32563
8cDq4 186 6,72948
8kIeI 186 6,73215
8kT4I 193 6,31427
8lVu1 193 7,62679
8sHKK 193 8,86571
DNMA 193 6,73817
NcYw 193 7,62310
OfeB 174 6,89647
mXev 186 6,73215
o1Rn 186 6,73215
zjdK 193 8,86610
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_7577
5vW8a
366 37,6% 130 2.032E-14
2 phalp2_28839
4XJZ6
27 40,0% 100 1.023E-08
3 phalp2_22059
5CcNX
221 31,0% 100 2.285E-07
4 phalp2_28119
INv
1 32,6% 101 2.721E-06
5 phalp2_9022
55wd4
28 34,0% 91 3.211E-05

Domains

Domains
Unannotated
Representative sequence (used for alignment): 4z1XK (138 AA)
Member sequence: 7tEpO (194 AA)
1 138 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4z1XK) rather than this protein.
PDB ID
4z1XK
Method AlphaFoldv2
Resolution 95.01
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50