Protein
- Protein accession
- 7ifKS [EnVhog]
- Representative
- 7t2Ng
- Source
- EnVhog (cluster: phalp2_17747)
- Protein name
- 7ifKS
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MSFRTVNGNTHTEDGWRCCNRDECDIVRIPELYLVDTAPLRKGAPLTILGAWLYWYDRNVEEITSPVWGWSATNDVLGTPGRNDGSNHLSGTAVDVMAPKYPWQQYTMNAATQAKVRKGLALFEGSVFWGRDWSRPDEMHYQMAWPEGDKRNDAFAAKLRAGYLGIYAPAQPQVPVQKRFPQDLTDRELLEYIAAQLGPGHPDWASKGMTLRDKVWSK
- Physico‐chemical
properties -
protein length: 218 AA molecular weight: 24747,6 Da isoelectric point: 6,43 hydropathy: -0,58
Representative Protein Details
- Accession
- 7t2Ng
- Protein name
- 7t2Ng
- Sequence length
- 238 AA
- Molecular weight
- 26351,02160 Da
- Isoelectric point
- 5,97335
- Sequence
-
MSTRTYNGNTHSYNGWPFITAAAIVRATVPGTADVRIEIRRGEVATILNAWAALWHRRVRPLDTYRPRDYWGWSATNDHPTSCHLSGTAVDLNATTLPFRHRTMPAQQRATVDEMVHQFRGVVAWGGHWSNPADEMHAEIALPPGDRRVADLAADLSAGYLGVYGSPTTPPPPAPPREDDDMTPEQARIQREIWEQLRGPNGKGWPQLGTNADGENLSLVDAVAALRDELAHRDEAPK
Other Proteins in cluster: phalp2_17747
| Total (incl. this protein): 129 | Avg length: 234,3 | Avg pI: 6,19 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7t2Ng | 238 | 5,97335 |
| 1d7hI | 247 | 9,07291 |
| 1jVaF | 195 | 5,27343 |
| 1mLHV | 247 | 9,07291 |
| 1pAf5 | 211 | 9,12571 |
| 2dgiF | 256 | 5,17169 |
| 3NRl9 | 215 | 5,62407 |
| 3Y80n | 184 | 5,90775 |
| 3Y8xI | 185 | 5,30486 |
| 3eYMq | 215 | 6,09805 |
| 44WSh | 191 | 5,69984 |
| 4FJcr | 225 | 5,23984 |
| 4ToVp | 189 | 5,59196 |
| 5BApo | 207 | 4,33650 |
| 6QpkC | 190 | 5,62038 |
| 6RtLH | 219 | 6,07657 |
| 6YaVO | 236 | 6,44244 |
| 6YfwB | 256 | 8,66805 |
| 70jgz | 228 | 5,35738 |
| 72449 | 235 | 6,30574 |
| 72EMv | 217 | 5,49783 |
| 72EYo | 211 | 5,67795 |
| 72ufp | 237 | 5,51187 |
| 72ujr | 333 | 6,33029 |
| 76np0 | 215 | 6,43226 |
| 79FQC | 215 | 6,09805 |
| 79IXn | 218 | 6,07486 |
| 79IZe | 236 | 6,65109 |
| 7AFQU | 235 | 5,59434 |
| 7AFVn | 237 | 5,23921 |
| 7AGgE | 234 | 5,42098 |
| 7ALuL | 227 | 5,78191 |
| 7AVu9 | 185 | 5,57189 |
| 7AoLU | 220 | 5,00867 |
| 7PKoI | 198 | 5,71183 |
| 7PLby | 234 | 5,96101 |
| 7PWFQ | 225 | 6,22401 |
| 7Q1jt | 221 | 6,90732 |
| 7aKWt | 247 | 9,07291 |
| 7b6cB | 214 | 5,53944 |
| 7fsv5 | 215 | 6,09805 |
| 7gRaM | 184 | 5,00168 |
| 7ht7h | 222 | 5,96783 |
| 7kFCp | 215 | 6,09805 |
| 7lGpy | 179 | 5,03471 |
| 7lGtG | 179 | 4,91353 |
| 7nRxb | 248 | 6,10481 |
| 7o333 | 245 | 6,60568 |
| 7o3lP | 180 | 5,36534 |
| 7ocRl | 218 | 7,88218 |
| 7of33 | 182 | 5,62907 |
| 7oh0R | 252 | 9,51922 |
| 7oieE | 186 | 6,20178 |
| 7pHrt | 215 | 6,43079 |
| 7pJPJ | 215 | 5,83557 |
| 7pMAv | 215 | 6,09805 |
| 7pMaH | 218 | 6,09777 |
| 7pPaD | 215 | 6,09805 |
| 7pQDr | 215 | 6,90863 |
| 7pQMg | 216 | 5,77185 |
| 7pQNP | 215 | 6,30108 |
| 7pR0C | 219 | 6,09777 |
| 7pRGn | 215 | 5,82562 |
| 7pSUn | 215 | 6,43079 |
| 7pb0I | 246 | 9,51175 |
| 7q5cA | 214 | 6,73976 |
| 7qb8S | 215 | 6,09805 |
| 7qhxH | 211 | 5,50278 |
| 7qluq | 215 | 5,54876 |
| 7qqx7 | 236 | 6,44392 |
| 7qr1t | 188 | 4,80781 |
| 7qrbL | 187 | 4,70856 |
| 7r8V1 | 236 | 6,11789 |
| 7ubGk | 208 | 5,28514 |
| 7ud7V | 218 | 5,95578 |
| 7ujwH | 220 | 5,52227 |
| 7ujxA | 224 | 5,85899 |
| 7vnaG | 204 | 5,03601 |
| 7xjoU | 230 | 7,74542 |
| 7yfSq | 236 | 6,44250 |
| 7ykiL | 224 | 5,94419 |
| 7zSEw | 177 | 8,71002 |
| 7zSgg | 225 | 6,44187 |
| 8CGWw | 192 | 6,05377 |
| 8HwzH | 245 | 7,05732 |
| 8HwzL | 260 | 5,85290 |
| 8HwzM | 237 | 5,82801 |
| 8Hwzn | 211 | 5,95783 |
| 8L0wn | 244 | 9,44992 |
| 8Lg2x | 196 | 5,92344 |
| 8Lggz | 192 | 5,92140 |
| 8Lni6 | 196 | 6,12846 |
| 8M1xc | 226 | 6,52849 |
| 8MDGF | 177 | 7,84833 |
| 8MH4q | 234 | 6,53321 |
| 8MHYv | 237 | 5,82392 |
| 8MK41 | 237 | 5,83392 |
| 8Mw9f | 177 | 8,71002 |
| 8N0Lw | 190 | 6,96405 |
| 8lHXk | 229 | 5,58860 |
| 8nLEt | 223 | 7,77613 |
| DEKp | 228 | 5,89292 |
| Nu17 | 227 | 5,57701 |
| O2gk | 227 | 5,57695 |
| OUWO | 230 | 9,22338 |
| VNuU | 193 | 5,54006 |
| p8Dr | 227 | 5,89292 |
| wULI | 230 | 5,34312 |
| zhvA | 204 | 5,88610 |
| X2KYU5 | 325 | 5,33925 |
| B5U3R2 | 327 | 5,83301 |
| A0A2P1N5K3 | 327 | 5,83301 |
| A0A2Z4Q1Y2 | 329 | 5,66664 |
| A0A2Z5HEM8 | 327 | 5,83301 |
| A0A3G2KGU1 | 327 | 5,83301 |
| A0A481VTJ4 | 327 | 5,83301 |
| A0A481W6F1 | 327 | 5,83301 |
| A0A482J906 | 327 | 5,83301 |
| A0A5B8RNZ9 | 327 | 5,83301 |
| A0A5J6TVV3 | 327 | 5,83301 |
| A0A5P8DAD7 | 327 | 5,83301 |
| A0A7M1CNY9 | 327 | 5,83301 |
| B2ZNT3 | 327 | 5,83301 |
| B5U3H7 | 327 | 5,83301 |
| B5U401 | 327 | 5,83301 |
| G8IAP4 | 327 | 5,83301 |
| Q19YB3 | 327 | 5,83301 |
| Q19ZD2 | 327 | 5,83301 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_10559
8qH8D
|
11 | 36,3% | 165 | 3.495E-40 |
| 2 |
phalp2_5098
1IyeS
|
221 | 38,7% | 178 | 9.660E-28 |
| 3 |
phalp2_19831
5lDZw
|
29 | 38,5% | 153 | 1.151E-26 |
| 4 |
phalp2_426
7yZXo
|
3 | 30,5% | 236 | 2.603E-23 |
| 5 |
phalp2_19694
4HC63
|
25 | 34,1% | 158 | 6.566E-19 |
| 6 |
phalp2_40429
4f3sa
|
2 | 29,4% | 197 | 1.808E-15 |
| 7 |
phalp2_38848
1Icxu
|
17 | 30,1% | 159 | 4.161E-13 |
| 8 |
phalp2_20751
5n7OP
|
24 | 28,3% | 201 | 2.525E-12 |
| 9 |
phalp2_20765
5wg3n
|
29 | 28,3% | 162 | 1.660E-10 |
| 10 |
phalp2_12509
Z7sC
|
31 | 27,1% | 184 | 1.788E-09 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7t2Ng)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50