Protein
- Protein accession
- 7hnMN [EnVhog]
- Representative
- 8pawf
- Source
- EnVhog (cluster: phalp2_21492)
- Protein name
- 7hnMN
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAASTYKSAMAHLRRDEGGFVHHKLDPGGATNFGITQAVYDTYRKRIGLKTRSVREIAEVEVSSIYQTQYADKVRYDALPAGVDYATLDAAVNSGVSRGAKWLQLSVGAFVDGQVGPQTVAKAKAADPIKTIKAIYARRTSFVQGLKNFVTFGKGWMRRLTLGEANAVKMQLETRTTSARGVIAHLEAEATVATNISKSQNSAAGASAVASGTSTTSAATITDLDTATIVILSVVAVGLVVLTIHLVRKSRINRDRAAAYAAVASGATP
- Physico‐chemical
properties -
protein length: 269 AA molecular weight: 28418,0 Da isoelectric point: 9,99 hydropathy: 0,00
Representative Protein Details
- Accession
- 8pawf
- Protein name
- 8pawf
- Sequence length
- 216 AA
- Molecular weight
- 23837,13760 Da
- Isoelectric point
- 9,42542
- Sequence
-
MKDNFEACCSFVRSQEGGFVDDPHDPGGRTMEGITQITYHDAGLKVNVKGITTAEWNRIARTVYWDKIKGDEIPEGEDLTMFDFAFNSGPAVALKKRRGLKGTPDDIIKAIAERRLTFLHALRNWHYFGRGWTRRVTQCEALSLKMAGSVLGIRVEAKKALVESNKTATQAAVALGTAIPLAHLAPMVATIPAATGAFLVWKSHRHSQRSKTLMEA
Other Proteins in cluster: phalp2_21492
| Total (incl. this protein): 134 | Avg length: 257,4 | Avg pI: 9,40 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8pawf | 216 | 9,42542 |
| 10mXd | 264 | 9,78935 |
| 11AJL | 258 | 9,65035 |
| 11ioC | 253 | 10,18937 |
| 1afjr | 252 | 9,73042 |
| 1bKQ6 | 252 | 9,73120 |
| 1bOJb | 266 | 9,79779 |
| 1cnAj | 252 | 9,68162 |
| 1cpkc | 252 | 9,60310 |
| 1dHRm | 266 | 9,05776 |
| 1dJJE | 275 | 9,21171 |
| 1dVNi | 252 | 8,76340 |
| 1eWin | 278 | 8,88350 |
| 1fQIA | 264 | 9,76685 |
| 1fSwp | 265 | 9,51587 |
| 1fu1R | 281 | 10,40354 |
| 1klBm | 260 | 9,76098 |
| 1lygL | 258 | 9,78051 |
| 1oBjk | 258 | 9,56938 |
| 1pDHS | 237 | 5,62879 |
| 1qZuM | 257 | 9,64055 |
| 1r43p | 252 | 9,77471 |
| 1rmzC | 252 | 9,70676 |
| 1rpiL | 264 | 9,77317 |
| 1rt2U | 264 | 9,81301 |
| 25oxV | 240 | 9,78097 |
| 2FnKB | 242 | 9,86664 |
| 2Gd4 | 263 | 9,33278 |
| 2IKTe | 257 | 8,79215 |
| 2MfqI | 287 | 9,56596 |
| 2XgUK | 272 | 7,04885 |
| 2bwiX | 276 | 6,10800 |
| 2gnFu | 263 | 9,53747 |
| 2jMWY | 254 | 6,92091 |
| 2kJu1 | 220 | 9,65261 |
| 2kW4y | 305 | 6,45352 |
| 2n0WH | 267 | 9,64171 |
| 2prEE | 258 | 9,65113 |
| 2rvRG | 266 | 9,39777 |
| 36Wnt | 236 | 8,94049 |
| 3NrSt | 258 | 9,83583 |
| 3OMN3 | 255 | 9,92525 |
| 3OTjC | 268 | 9,64410 |
| 3ObSb | 204 | 9,93163 |
| 3QWgd | 258 | 9,83583 |
| 3W8Ki | 250 | 9,83447 |
| 3XKD2 | 240 | 9,88682 |
| 3aUxI | 268 | 10,17841 |
| 3bLkA | 259 | 10,05470 |
| 3bNuC | 240 | 9,78161 |
| 3bXEM | 268 | 9,64694 |
| 3zOAE | 233 | 9,25748 |
| 43LJX | 245 | 9,94175 |
| 47WP | 255 | 9,78960 |
| 4CbDh | 250 | 10,08564 |
| 4CyLh | 250 | 9,99648 |
| 4Frvu | 271 | 6,60432 |
| 4FzWn | 268 | 7,86393 |
| 4Jumu | 250 | 6,66366 |
| 4KK5a | 258 | 9,98610 |
| 4KU7o | 258 | 10,16842 |
| 4Kk59 | 258 | 9,77845 |
| 4Ktha | 252 | 10,57728 |
| 4Ng1O | 291 | 10,70299 |
| 4OVY9 | 273 | 9,51716 |
| 4PweV | 255 | 9,01940 |
| 4QTCz | 265 | 9,51129 |
| 4UAdE | 252 | 9,88676 |
| 4UcWL | 258 | 10,05515 |
| 4UqUT | 257 | 9,70257 |
| 4WoBY | 251 | 8,73323 |
| 4WsMA | 267 | 9,93556 |
| 4eIxE | 245 | 9,76188 |
| 4o4Zc | 261 | 9,85975 |
| 4t2VG | 254 | 10,04045 |
| 4uEfu | 237 | 5,62879 |
| 4uF0w | 249 | 9,84318 |
| 56pHL | 247 | 10,02956 |
| 5DM2S | 238 | 5,28520 |
| 5EiT9 | 253 | 9,88257 |
| 5ElFs | 272 | 9,78838 |
| 5Ham0 | 261 | 9,62012 |
| 5HoAH | 241 | 7,86800 |
| 5IUyY | 272 | 10,20439 |
| 5pv0Y | 247 | 10,16320 |
| 5sHqr | 265 | 9,74383 |
| 5z1sQ | 259 | 9,45637 |
| 6DSBe | 271 | 9,73042 |
| 6DcgQ | 270 | 7,12024 |
| 6KNVB | 261 | 9,51632 |
| 6QWLr | 265 | 7,83176 |
| 6Ra0Q | 266 | 8,89150 |
| 6TeKP | 270 | 9,66054 |
| 72xuZ | 261 | 9,59278 |
| 752Lh | 252 | 9,51607 |
| 7c7hZ | 248 | 9,97057 |
| 7cZVU | 252 | 9,70715 |
| 7cuU3 | 244 | 9,65925 |
| 7dfWo | 268 | 9,83899 |
| 7e78 | 252 | 9,61825 |
| 7ffcq | 240 | 9,84118 |
| 7ffeL | 258 | 9,58814 |
| 7gCDS | 263 | 10,03755 |
| 7gEDg | 270 | 9,89404 |
| 7jTqH | 249 | 9,66099 |
| 7lJ11 | 263 | 9,43896 |
| 7m8ZE | 269 | 9,31673 |
| 7oh6p | 252 | 9,70715 |
| 7ooua | 258 | 9,93447 |
| 7qwzS | 252 | 9,68162 |
| 7r7Yc | 278 | 9,75660 |
| 7sEnn | 252 | 9,88676 |
| 7sGBS | 252 | 9,62644 |
| 7tSsm | 263 | 10,13619 |
| 7tcLg | 270 | 9,73178 |
| 7u9Du | 262 | 9,79811 |
| 7wH7y | 271 | 9,78870 |
| 7xCYr | 245 | 9,71966 |
| 7xGBb | 254 | 10,27163 |
| 7zlVO | 265 | 9,55797 |
| 8LZCZ | 271 | 9,97102 |
| 8eIf6 | 267 | 9,99513 |
| 8ehwe | 262 | 10,11839 |
| 8jtGI | 245 | 9,61580 |
| 8oJSB | 246 | 9,84176 |
| 8pbxC | 216 | 9,53889 |
| 97FU | 238 | 5,34886 |
| PwcY | 268 | 9,73448 |
| f18P | 275 | 10,69423 |
| f4hh | 255 | 9,57641 |
| gQp6 | 269 | 9,67691 |
| hlxP | 236 | 8,94049 |
| pL41 | 274 | 9,51632 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_14059
8aO3S
|
400 | 40,9% | 171 | 2.461E-69 |
| 2 |
phalp2_18877
1MrjM
|
564 | 37,5% | 176 | 2.303E-62 |
| 3 |
phalp2_37851
4LyyS
|
5845 | 38,2% | 170 | 5.920E-62 |
| 4 |
phalp2_4978
6Oe3B
|
241 | 34,7% | 207 | 4.379E-59 |
| 5 |
phalp2_1403
1nDVZ
|
22 | 37,2% | 236 | 1.393E-57 |
| 6 |
phalp2_12946
360Ik
|
1926 | 34,7% | 167 | 9.189E-57 |
| 7 |
phalp2_34743
3e4sK
|
352 | 37,0% | 170 | 4.427E-56 |
| 8 |
phalp2_36337
jh4L
|
2 | 32,2% | 239 | 1.937E-51 |
| 9 |
phalp2_20698
4XKIk
|
408 | 30,4% | 164 | 2.156E-49 |
| 10 |
phalp2_23908
1Le4q
|
257 | 32,5% | 163 | 1.275E-44 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8pawf)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50