Protein
- Protein accession
- 7ZRcB [EnVhog]
- Representative
- 18TMj
- Source
- EnVhog (cluster: phalp2_2984)
- Protein name
- 7ZRcB
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 96% (predicted by ML model) - Protein sequence
-
MCYAESRHNATVINKYDGGSPSIGLCQLKVETAKLVGFDGGVEDLKDPLTNAFYAGKYLKQQLIRYDGNIPNAIGAYNAGPKGVDRCLKKFGKVCSVKHVRRVMQHWTAGK
- Physico‐chemical
properties -
protein length: 111 AA molecular weight: 12190,9 Da isoelectric point: 9,46 hydropathy: -0,38
Representative Protein Details
- Accession
- 18TMj
- Protein name
- 18TMj
- Sequence length
- 145 AA
- Molecular weight
- 16203,80720 Da
- Isoelectric point
- 9,57151
- Sequence
-
MTKTIILLSLLSIKALAVTDVIIKAANTVGVDSKVLKAICWVESSHNPKAINYNDGNGHNSMGLCQVQYPTAKDMGYKGTKLGLLEPYTNAYYAAKYLKYQLTRYKDIDLAILAYNAGSIRYNKKGLIINFNYLNKVKKALKIYE
Other Proteins in cluster: phalp2_2984
| Total (incl. this protein): 135 | Avg length: 147,0 | Avg pI: 9,17 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 18TMj | 145 | 9,57151 |
| 11gbK | 156 | 9,05795 |
| 18TU3 | 141 | 9,78980 |
| 1HMjs | 167 | 9,31673 |
| 1Ho0R | 128 | 9,33575 |
| 1If28 | 134 | 9,16684 |
| 1J0zy | 129 | 9,84421 |
| 1LvST | 125 | 9,55152 |
| 1PVAg | 131 | 9,62740 |
| 1Pvm8 | 164 | 10,03755 |
| 1QRUm | 164 | 10,03755 |
| 1QS4U | 122 | 9,61045 |
| 1Qv0R | 131 | 9,62740 |
| 1Y2WY | 138 | 8,53499 |
| 1ZfL9 | 157 | 8,79769 |
| 1lSsR | 148 | 9,28533 |
| 1ovzG | 125 | 9,48950 |
| 23YLB | 152 | 9,19276 |
| 255xq | 142 | 9,82094 |
| 2KDb4 | 183 | 9,17651 |
| 2L8hR | 132 | 8,32160 |
| 2SShk | 159 | 9,96322 |
| 34hMS | 152 | 9,82468 |
| 36jsH | 127 | 9,73049 |
| 39lcX | 136 | 9,82738 |
| 3AfKN | 141 | 8,92618 |
| 3BcCv | 148 | 9,06717 |
| 3LtFl | 162 | 9,51542 |
| 3Wrv | 146 | 9,39093 |
| 3Yku | 144 | 8,51822 |
| 3f1Gv | 135 | 9,13409 |
| 3f5dX | 145 | 8,82445 |
| 3g1QW | 147 | 6,28073 |
| 3hPwu | 147 | 9,17071 |
| 3lA4Q | 130 | 9,48912 |
| 3lzSn | 139 | 7,77671 |
| 3njP9 | 197 | 9,04583 |
| 3nkEp | 196 | 8,93701 |
| 3nru6 | 205 | 9,38049 |
| 3z0OS | 143 | 9,42794 |
| 3z1vx | 152 | 6,08083 |
| 3z5VK | 174 | 8,52596 |
| 3zPG4 | 127 | 9,48087 |
| 3zRVG | 133 | 9,59704 |
| 3zWAZ | 155 | 9,27044 |
| 3zbHN | 142 | 8,91541 |
| 3zku1 | 144 | 10,00764 |
| 3zmPf | 145 | 9,37024 |
| 3zn3P | 155 | 9,19340 |
| 3znF8 | 148 | 7,60934 |
| 484ol | 154 | 9,86948 |
| 4CKMv | 161 | 10,09190 |
| 4H0e9 | 197 | 9,43490 |
| 4H7PC | 202 | 8,80749 |
| 4HDoD | 128 | 9,62785 |
| 4IqTg | 142 | 9,35174 |
| 4Js7x | 148 | 9,15788 |
| 4Jzvc | 151 | 9,17471 |
| 4K4Ww | 152 | 9,22377 |
| 4KRvC | 146 | 9,51516 |
| 4Kth1 | 188 | 9,56725 |
| 4MEpl | 152 | 9,07059 |
| 4MpSY | 186 | 9,69716 |
| 4Y1SF | 144 | 8,63304 |
| 4Y4FP | 142 | 9,67376 |
| 4Y4Xy | 143 | 8,98775 |
| 4dKkH | 124 | 6,17188 |
| 4dMEO | 140 | 9,63714 |
| 4dOQj | 133 | 9,45166 |
| 4dSHb | 142 | 9,21126 |
| 4dzVD | 142 | 9,37855 |
| 4fk8J | 137 | 10,11046 |
| 4ftCZ | 132 | 8,81639 |
| 4hEnG | 142 | 9,78529 |
| 4wUFx | 178 | 9,10972 |
| 565gm | 156 | 9,30055 |
| 5BcaH | 130 | 7,81552 |
| 5HdrR | 138 | 9,63449 |
| 5IMLT | 160 | 9,37552 |
| 5Igm5 | 128 | 9,30055 |
| 5fcK3 | 165 | 9,14460 |
| 5wXbY | 154 | 9,79083 |
| 5zMBX | 141 | 9,51684 |
| 6Dcp4 | 135 | 9,34464 |
| 6GvME | 164 | 9,81842 |
| 6HSSV | 195 | 9,03990 |
| 6IcNh | 190 | 9,34239 |
| 6IiMQ | 142 | 8,25074 |
| 6Iiyw | 128 | 9,64487 |
| 6IjQO | 127 | 9,20623 |
| 6Il52 | 155 | 9,81468 |
| 6KTD1 | 165 | 9,60690 |
| 6NcDA | 154 | 9,37546 |
| 6Ncs4 | 160 | 9,37578 |
| 6NtiF | 128 | 9,43909 |
| 6OS26 | 142 | 9,93575 |
| 6QPHA | 133 | 9,06749 |
| 6QSPn | 125 | 9,95503 |
| 6QST4 | 149 | 8,30271 |
| 6T2KZ | 142 | 9,42916 |
| 6Txqp | 153 | 9,05757 |
| 6Ty2r | 141 | 9,57434 |
| 6Vgqj | 168 | 8,25036 |
| 6WGKV | 142 | 9,24581 |
| 6WGWH | 154 | 9,51323 |
| 6We6m | 145 | 9,45798 |
| 6WkLS | 129 | 9,75589 |
| 6XHY9 | 145 | 9,34368 |
| 6XKuj | 144 | 6,57413 |
| 6XPEq | 153 | 9,11095 |
| 6XX9J | 152 | 9,68639 |
| 7EPM0 | 134 | 6,81911 |
| 7YhkL | 141 | 10,10847 |
| 864GW | 153 | 6,89414 |
| 86HXy | 149 | 10,10486 |
| 86I02 | 166 | 9,04590 |
| 86KFl | 127 | 8,58102 |
| 86L6N | 152 | 9,12964 |
| 873hz | 125 | 9,41620 |
| 87hhK | 167 | 9,74854 |
| 8ajbz | 138 | 9,31750 |
| 8i3ob | 125 | 9,54656 |
| 8i61u | 128 | 9,61116 |
| 8i6RJ | 139 | 9,51568 |
| 8i6iu | 125 | 9,48950 |
| 8i6k5 | 139 | 9,41930 |
| 8njUu | 128 | 9,30068 |
| Q8is | 153 | 9,75660 |
| Y8Kw | 127 | 9,59742 |
| dfZA | 146 | 8,96196 |
| hheY | 146 | 9,49453 |
| j66x | 139 | 9,54063 |
| lFpp | 134 | 7,81816 |
| nAEm | 133 | 6,27414 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_31084
1Qr5e
|
8 | 48,1% | 108 | 5.501E-34 |
| 2 |
phalp2_15631
2zmyJ
|
7 | 44,7% | 123 | 6.231E-32 |
| 3 |
phalp2_27050
2cnxE
|
19 | 35,2% | 142 | 3.488E-26 |
| 4 |
phalp2_25230
3NWsD
|
5 | 31,3% | 153 | 4.866E-23 |
| 5 |
phalp2_22364
ht2E
|
5 | 30,7% | 114 | 4.435E-19 |
| 6 |
phalp2_3406
3Pi2s
|
331 | 32,8% | 152 | 6.072E-19 |
| 7 |
phalp2_25771
7CoqA
|
3 | 33,3% | 126 | 2.919E-18 |
| 8 |
phalp2_39704
bZih
|
3 | 30,5% | 131 | 2.919E-18 |
| 9 |
phalp2_21100
mnNR
|
41 | 35,9% | 128 | 7.486E-18 |
| 10 |
phalp2_37089
16u4b
|
9 | 32,0% | 131 | 1.025E-17 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(18TMj)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50