Protein

Protein accession
7YE0m [EnVhog]
Representative
3e47a
Source
EnVhog (cluster: phalp2_31682)
Protein name
7YE0m
Lysin probability
97%
PhaLP type
endolysin
Probability: 96% (predicted by ML model)
Protein sequence
MKRYRDYTEQSSASKEHMKKVAKMAEYDSMEREKADMTNFRRKPYSVPIKNRILILIAIMLFVPVIQVKAAEDTYLSEEIQEACIKYGDEYNICPELIMAIIEKESRGNPDVENGSCKGLMQINIIFQKDRMKRLGVKDIFSVDGNIHLGADYLAELISENDDVYYVLMAYNMGSAKAKELYDQDIFSRYAVSVSNRAAEIERAKGK
Physico‐chemical
properties
protein length:207 AA
molecular weight:23797,1 Da
isoelectric point:5,86
hydropathy:-0,42
Representative Protein Details
Accession
3e47a
Protein name
3e47a
Sequence length
205 AA
Molecular weight
23471,35760 Da
Isoelectric point
4,91603
Sequence
MLKKNIYSIILAIVLGMIFGAAHIDSCNRKKTEEGLILNITHTVIEEEPVIIQETVKSIEPIEIEVTEMKYTDPDIPDEVEEAAIKYGEEYNIQPEFLEALAWRESRYHPDAVSSDGSCIGLCQINPKWHKERMKRTGKDDLYQIDDNMNIAADYLADLFKDHSGDPEIVLMIYNGDHSYKKGNISKYAQDIVNKSQELERKHGK
Other Proteins in cluster: phalp2_31682
Total (incl. this protein): 166 Avg length: 188,3 Avg pI: 5,12

Protein ID Length (AA) pI
3e47a 205 4,91603
13DIe 188 4,75347
13rcD 206 4,88192
19nRJ 223 4,46546
1NzbW 224 4,45933
1cBVc 216 4,43517
1ctpV 213 4,44654
1cuFo 213 4,44654
1cui2 216 4,42471
1fEsH 186 9,58518
1k7Q3 223 4,90699
1ktxn 182 4,42863
1m9af 187 4,70612
1mprN 210 4,25340
1ob4j 239 4,43562
21Ivp 211 4,53396
21OA7 217 4,37020
21PbX 128 4,49246
21hoC 217 4,39106
21tqb 142 4,65872
235Wc 152 5,39183
24ptp 217 4,39220
24rmp 213 4,44654
2VGF0 235 9,48448
2lClr 216 4,43625
2muBe 198 4,81832
2pen1 198 4,47683
35KIT 252 4,84521
3GBU1 157 4,24271
3Pcys 232 9,39893
3SYaA 221 8,28285
3TCb9 187 5,49590
3TEDL 190 5,57394
3VIxH 205 4,69771
3WIfw 154 4,52066
3ZAVB 213 4,39072
3ZZyF 227 4,29188
3dX6i 221 5,22512
3fXaP 222 4,81389
3i007 233 9,37649
3icHJ 199 4,52492
3myQu 157 4,51150
3p8eQ 157 4,35355
3sTJj 158 4,54112
3tFJI 157 4,48041
3tvxz 157 4,48041
3uxCU 157 4,60955
3v5Uo 162 4,85299
3vwbH 158 4,52378
3ynNV 207 4,29643
40Cpm 216 4,42238
40IOZ 217 4,39220
41lxr 206 4,21003
41nlg 182 4,87687
45mW6 211 4,65082
4FCaL 215 4,61126
4Zfl8 204 8,66250
4e1Kt 228 9,58672
4xCL6 222 8,11910
4y6jR 226 4,32649
4yaIH 174 4,06691
4yiOp 225 4,52105
4yjMR 161 5,17413
4yrGu 228 4,63217
4yrnX 195 4,23095
4yvyr 221 4,22884
4ywMk 227 4,44193
5MgD2 203 4,14995
5Mnxt 164 5,49328
5NVy6 155 4,32922
5NYpp 225 4,27278
5Nq6u 221 4,62370
5O3Ai 133 4,91421
5PZ37 211 4,27000
5Qqu6 158 4,84140
5R3q9 180 5,05204
5Ryog 224 4,43722
5SRg5 216 4,31274
5STHV 160 4,62711
5Xd2q 158 4,44620
5XxLd 216 4,31274
5Y9NK 211 4,22725
5hRBK 176 4,69680
5qO7 176 4,40567
60sBs 180 5,05369
61zPw 167 4,92302
62wML 167 5,02976
65GFC 231 4,17445
66KLR 159 4,37282
66jXY 195 4,99515
66x1O 211 4,27096
67GtI 216 4,31274
68eaJ 180 5,15839
6An5C 162 4,79166
6F47u 240 9,63391
6YzMP 168 5,06500
6ZZ1E 147 5,64868
6aWhr 138 4,59773
6czUI 211 4,40851
6dquG 166 4,05003
6eUfy 179 5,15720
6hDpu 158 4,47507
6i3t0 119 4,56442
6iVcp 119 4,42022
6jjfg 158 4,54112
6jy1k 182 4,81508
6lPSg 205 4,21549
6lzh0 207 4,40004
6nAxj 158 4,44443
6nOWC 169 4,96076
6nYPb 119 4,42022
6nlJt 180 5,15839
6pQdP 158 4,47507
6q5Q 216 4,44688
6tMqI 158 4,52128
6tR8P 158 4,54385
6tWrn 211 4,22725
6tmwQ 169 4,96076
6uiYv 158 4,52691
6w37N 195 4,48149
6wuhU 168 4,53873
75Vr4 195 4,41300
79PDf 169 4,76336
7NQRA 157 4,53873
7OF31 197 9,43832
7VZ7R 137 4,68486
7WSxj 208 4,52276
7WiYQ 157 4,48041
7XwJE 171 5,31106
7YBMW 217 4,47132
7YwrM 158 4,61580
7YyX7 217 4,39294
7bl1L 181 9,06898
7kUmA 220 4,75370
7pdsl 220 4,65684
813Dt 157 4,22816
81Xed 157 4,48041
8356l 216 4,46944
83UJt 166 4,87829
84Pfl 158 4,46052
85mJr 224 4,39106
86ilp 158 4,52128
87Xpv 158 4,58136
88pA9 206 6,52775
8MNg0 217 4,37310
8bLLr 158 4,42755
8fqTJ 158 4,46052
8fxNE 158 4,58136
8kbDT 158 4,60063
8r6zF 158 4,55760
8rDPX 158 4,70749
8s6WI 158 4,58136
8sqXS 160 4,51736
8tPXQ 182 4,58647
8tbRJ 162 4,34553
C4M5 197 9,15872
C4cF 197 9,36598
CE1A 197 9,15872
IFVW 168 5,15270
NL8t 210 4,25340
O4CO 197 9,53844
OqIa 197 9,53844
oE5D 197 9,59278
yhxf 168 5,04255
ypTm 211 9,59220
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_21453
8dUxm
28 40,6% 219 1.875E-52
2 phalp2_16046
3Q4hp
22 33,3% 180 1.383E-49
3 phalp2_31447
3o77A
181 35,7% 137 2.342E-48
4 phalp2_21456
83Hl4
5 36,9% 211 9.175E-46
5 phalp2_5516
3nOii
6 34,8% 152 2.121E-41
6 phalp2_30280
4kfmc
1 34,1% 205 3.544E-37
7 phalp2_600
139Z6
763 30,7% 140 2.324E-36
8 phalp2_38604
24Hma
11 29,5% 159 4.349E-36
9 phalp2_31126
24IN1
1 38,0% 134 1.523E-35
10 phalp2_4037
19be8
11 32,1% 140 3.122E-33

Domains

Domains
Disordered region
SLT
Representative sequence (used for alignment): 3e47a (205 AA)
Member sequence: 7YE0m (207 AA)
1 205 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01464

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3e47a) rather than this protein.
PDB ID
3e47a
Method AlphaFoldv2
Resolution 81.48
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50