Protein

Protein accession
7WDQE [EnVhog]
Representative
QCVp
Source
EnVhog (cluster: phalp2_15223)
Protein name
7WDQE
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTVKYIILHWTGGGCKPNTIDLNSYQMIVDTTGQVYNGKPQGKSSSTGGMNSITYNISCCGGGTIKLTTLQCERMFKETAVKLKQYGLSISDVYTHHEIGGMCRDRSIRKLLPFNKYLWQNIGKIDLTVLPYDTKGQSCGDFIRNKITWYLERV
Physico‐chemical
properties
protein length:154 AA
molecular weight:17360,9 Da
isoelectric point:9,23
hydropathy:-0,34
Representative Protein Details
Accession
QCVp
Protein name
QCVp
Sequence length
141 AA
Molecular weight
15878,11470 Da
Isoelectric point
9,29900
Sequence
VHKPEANLNIRSGQYAAHTRGLNTGSIGLAMDAMRQAVERPFDTGPEPITQVQLQAFVQMIAEYCTTYGIPVTRKTVLSHAEVQPTLGVWQRGKWDIAWLPGMLKPQDPVIVGDRIRKMVQDAIDGEHRPQPSFLTRFFLR
Other Proteins in cluster: phalp2_15223
Total (incl. this protein): 291 Avg length: 168,9 Avg pI: 8,94

Protein ID Length (AA) pI
QCVp 141 9,29900
136qO 163 8,84173
137Kz 163 8,80517
138SY 163 8,81388
139L4 164 9,20623
13a2v 168 7,58092
195OU 183 9,11269
195y1 181 9,05653
19dKF 174 9,37385
19fUt 147 8,45801
19htZ 172 9,23898
19iax 183 8,96525
19kgy 157 8,89143
19lHX 161 9,05602
19mSh 183 8,97215
19nkS 170 9,25071
1G1SE 163 9,27263
1G1YQ 163 8,45466
1IDPj 183 9,05679
1KpSc 177 9,43258
1LHnG 168 8,76056
1Nzg4 167 9,01637
1cCgc 165 9,12964
1ctUc 180 8,88299
1dR2N 162 9,14808
1dRLN 163 9,53547
1dRPH 141 9,47784
1dS8z 155 9,51458
1gwYc 166 8,72330
1hase 174 6,90823
1kB2v 167 8,74857
1miEF 163 9,10966
1ndfu 173 8,98452
1nwe2 165 9,42910
1qU3l 157 8,79956
1qUla 169 8,83264
1reHw 174 8,89420
1wTXZ 190 9,27553
21AZB 172 9,06421
21JuZ 163 9,03081
2COIA 169 9,01560
2F6zg 178 7,76014
2FcNq 185 10,12323
2OKq8 175 8,90639
2VccL 166 8,62453
2Vcmk 183 9,18760
2XK0I 163 9,19914
2XLQZ 166 8,61099
2ZNGE 170 8,83231
2oogr 140 9,00509
2owTg 163 8,78841
2z61 160 8,36640
38FLR 160 9,28359
38GFO 165 9,35715
38I1l 163 9,35973
38MGC 183 9,11269
38N7V 169 9,06459
3A0Kf 162 9,30100
3A3D3 166 9,04358
3A3Fw 166 9,07110
3A3Tz 171 9,06936
3A3iQ 163 9,24401
3A45g 163 8,79692
3A47t 166 9,01889
3A6Cx 163 9,44754
3A6DF 169 8,83283
3Ak7m 155 6,23554
3Ib5W 162 9,15827
3IcTo 169 8,98633
3IcTx 160 9,30093
3Jbtz 162 9,26709
3MpaM 177 8,04954
3PEp2 177 8,61383
3Paal 166 9,13899
3SWKY 162 8,94094
3SWiu 162 6,73613
3TLJP 157 8,94494
3TM3t 183 9,43883
3WC3P 166 8,87486
3WFZ9 162 9,12816
3WJY5 163 9,08516
3WNdK 130 9,16304
3Wyi1 158 9,09754
3ZpBc 208 9,55197
3caku 161 8,19311
3dfiv 170 8,83863
3dhLL 171 8,92869
3dqh5 171 9,00083
3duyu 163 9,00180
3fL9Z 163 9,02037
3fPzo 158 9,31557
3gOIc 157 8,81407
3ghFu 162 9,23124
3ghyV 174 8,57779
3ieOK 183 9,05673
3igmT 162 8,90581
3iiqS 165 9,03481
3ilXJ 142 7,81700
3j3Rf 166 9,04609
3kRAI 157 9,34355
3khV2 169 8,98633
3kpRX 119 6,02348
3l648 166 9,50201
3lIRz 166 9,04564
3mnVc 162 9,16142
3mncc 185 9,14382
3nPCb 183 9,12751
3nVJm 163 8,66283
3tCTL 162 9,26709
3tD1c 172 9,00870
3tIU7 196 9,07330
3vb7O 185 9,13544
3x1EQ 163 9,51813
3x4ZM 169 8,99361
4060o 165 8,71369
40EBQ 163 9,35444
41fzF 156 9,11991
41iTj 177 9,33059
41mVB 157 9,49531
42xb7 194 9,48751
45Bfi 165 9,38636
45fUr 163 9,37062
45mAd 137 8,69474
45pte 183 9,11236
45yws 165 9,46127
4DCjG 162 8,84508
4Hi6i 171 9,12087
4JYeY 163 9,28546
4L80x 142 9,26509
4ObAm 172 9,21603
4OdFf 159 9,16181
4OeS4 158 9,12842
4Uh5V 163 8,86764
4k9Xy 157 8,97215
4kZo5 163 8,89504
4kfi9 160 8,95281
4kiju 155 9,15246
4kn5e 149 8,90922
4pbs3 173 9,25574
4y7C9 163 8,15675
4y9ns 162 8,89453
4ycIV 163 8,64703
4ydqS 162 8,23579
4yghR 163 8,90594
4ygvm 136 8,86390
4yhMa 162 8,47426
4yhXu 163 9,34464
52q55 163 9,03055
59dgJ 163 8,69603
5BKp 165 9,22389
5Bz0 157 9,06556
5DoE 169 9,09767
5INDI 177 9,14041
5IY89 180 9,15749
5KESQ 163 9,01837
5KbHr 140 9,04848
5Kj9K 168 8,90935
5Lzh8 155 9,16091
5MMtI 166 9,51774
5NPBI 155 8,77893
5O7FS 162 9,44109
5P59c 169 8,98633
5P6AB 155 9,19733
5QUri 164 8,77075
5QtSh 162 9,45018
5TeQV 162 9,45817
5TsoE 162 8,92702
5U5fZ 163 9,13461
5U7tL 155 8,97498
5UHUl 155 8,97498
5VFZE 163 9,34381
5VoLz 155 9,17264
5XfjX 163 9,27038
5Xfz3 147 8,53015
5Y5XL 161 7,06852
5YJwi 163 9,13931
5Z4Rt 167 9,39287
5wKuv 143 9,03468
5xWp 169 8,85307
648Dq 162 7,67778
64FXD 184 9,19785
65VL7 170 8,21812
65rli 160 7,67300
65rv0 161 9,32782
66dUQ 163 8,87377
66hK8 173 8,97421
67C7O 155 8,93585
67uKT 157 9,08619
688pA 162 9,33446
68CE 159 8,94907
68xt 158 8,86197
68ym 171 9,15459
6ASCX 168 8,84998
6An05 168 9,11462
6W2s4 163 8,88266
6YSjR 162 9,14769
6bTis 161 9,15311
6bfhZ 161 9,27347
6c4E4 183 8,44138
6cDwz 155 8,86590
6ceX4 157 9,09760
6dux6 155 8,96460
6eYLF 155 9,06440
6gWfq 164 9,08548
6gs69 163 8,95745
6hO5J 155 9,12223
6hZmA 163 9,02037
6kLKH 163 9,10779
6kfkB 148 9,31596
6ktf9 162 8,24739
6lZXK 167 8,62608
6lnzH 147 9,42703
6n25N 160 9,36863
6oiRP 160 9,04119
6oyVb 185 9,08110
6p5wF 162 8,91709
6paUr 155 9,07510
6qCJd 167 8,78957
6qlwt 157 9,16091
6qpF2 165 8,98536
6qvHk 160 8,17312
6tz24 159 8,76752
6v5y6 175 8,64033
6vMK7 155 9,09779
70K8F 163 9,24220
70Kuj 169 9,07078
72vji 163 9,24220
7DNLs 183 9,12880
7If1L 162 9,26013
7QJ1x 183 9,20094
7QKj3 185 9,01953
7VlbB 190 9,53921
7WPN5 166 9,04564
7X9JD 185 9,08916
7mXT5 170 8,76565
7pZW8 174 9,08613
7pZWZ 183 9,05673
7pZY1 169 9,13280
7pZYy 165 8,86932
7q00J 172 9,00109
80BQo 174 9,00515
81XOL 164 9,44109
81oA8 185 8,82664
84SYm 157 8,93753
84U5G 161 9,20707
8bl2F 168 9,00090
8dyPl 165 9,40847
8eTT6 185 9,26193
8icKw 157 8,94733
8icah 169 9,12887
8icia 172 9,16168
8icq7 162 9,33446
8idPM 172 9,22467
8mOmY 185 9,08110
8nZpP 169 9,24175
8nerW 185 9,15208
8oUrm 185 9,08916
8rEbj 156 9,13454
8szgs 160 7,10126
8tU1A 164 9,28688
8vM8m 158 9,34755
8vtqK 161 9,25793
BKSL 206 9,00528
ExG6 179 9,39764
IoUA 219 7,16850
K4ag 161 8,76108
jLMz 163 9,11069
nslh 178 9,22467
o9jy 167 9,05389
oklA 173 9,10953
oosN 163 9,37875
A0A191VYU0 218 6,59704
A0A2Z4QHU5 215 7,01975
A0A191VYM4 217 7,10700
A0A2Z4QHJ1 217 7,06051
A0A3Q9R8T9 210 9,44612
A0A3T0IK12 210 9,83499
A0AA47KWI9 216 6,92170
A0AAE7S9U8 221 9,14937
A0AAE7SAV7 221 9,14937
A0AAE7SAW0 211 9,81088
A0AAE7SBB5 213 9,14937
A0AAE7VB42 213 9,14937
A0AAE7VB82 221 9,14937
A0AAX3C561 213 9,14937
A0AAX3C5F5 213 9,14937
A0AAX3C5T0 213 9,14937
A0AAX3C675 213 9,14937
A0AAX3C7R6 221 9,14937
C4NT73 190 7,01884
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_20427
3fLr8
7 36,9% 111 9.104E-48
2 phalp2_21458
8eHRi
401 56,3% 126 2.347E-47
3 phalp2_27664
6EnWw
2 37,9% 87 1.342E-18
4 phalp2_26583
8s4n7
984 30,2% 129 1.838E-18
5 phalp2_11261
6Jhk9
16 25,0% 148 6.008E-09
6 phalp2_16716
NN8X
4 22,5% 120 2.082E-08
7 phalp2_32054
5Hyk1
3 27,6% 112 5.282E-08

Domains

Domains
Unannotated
Representative sequence (used for alignment): QCVp (141 AA)
Member sequence: 7WDQE (154 AA)
1 141 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (QCVp) rather than this protein.
PDB ID
QCVp
Method AlphaFoldv2
Resolution 90.56
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50