Protein

Protein accession
19AB3 [EnVhog]
Representative
2zxe8
Source
EnVhog (cluster: phalp2_25410)
Protein name
19AB3
Lysin probability
90%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
MKMTSYFEICWIVMGLIVNPSRSPHSTGWSKLIAKSIPARMDQCLHVAKAADKFEIDPYLMIALAYYESRFEAGLTSSAGAKGVMQVKKQFVDCTGCSEIEYGIKAYQTWLINSQGDVCLALGRYTVGNKGKCGKRSKAILKLAADLACFASKDEDCHDC
Physico‐chemical
properties
protein length:160 AA
molecular weight:17623,4 Da
isoelectric point:8,54
hydropathy:-0,03
Representative Protein Details
Accession
2zxe8
Protein name
2zxe8
Sequence length
151 AA
Molecular weight
17111,77440 Da
Isoelectric point
8,78338
Sequence
MEHLYLCVCLLQSFYSDSWNDRIEKKMPDKISTCISVMDLAVEMDAPPNLAVAVAWHESGFNKHAVSKAGARGPMQVLPKYWCPNGKLEGCDLLVEGIRALKVYLAKYGDEKEALCHYNAGNKCTKKSRYYARRVLGTKKRLAYIESLVFE
Other Proteins in cluster: phalp2_25410
Total (incl. this protein): 226 Avg length: 152,6 Avg pI: 8,93

Protein ID Length (AA) pI
2zxe8 151 8,78338
116hB 148 10,14914
17wDG 179 9,11191
1AqGx 140 9,33852
1B4VO 155 10,18306
1JM3C 158 8,34319
1K370 173 8,95538
1K3jt 161 8,97440
1K4dO 161 8,84482
1K7sR 173 8,93714
1KlRe 158 8,03800
1Kmaf 172 8,70841
1MLWf 171 9,55088
1OBBW 172 8,54704
1OU2l 158 8,03884
1Oa0D 144 8,74664
1Oi8S 176 7,56092
1PcU6 168 8,54156
1Vg6z 163 8,98665
1Wsof 160 9,91087
1XWxP 146 5,70109
1fI0D 165 9,49866
1fjAh 135 8,47703
1g8qI 138 8,68578
1imUx 130 8,43358
1o9IE 158 7,43553
1qjRp 159 7,58411
1sZLM 121 8,09873
1vHHT 149 4,99748
22MP7 158 8,03884
22goB 145 6,82718
27DRF 145 8,44724
27k2R 161 10,55678
28e50 157 9,26129
2ACTa 148 9,53418
2HByS 145 8,45053
2Ii21 145 8,44724
2LJzJ 149 4,99748
2Tnwa 148 10,14914
2a2hl 158 9,81610
2acQa 145 8,45053
2mVl8 165 9,51342
2pDkP 159 9,58775
2rOW2 146 10,14605
2rxbi 162 10,29336
2vddH 106 11,22474
2vdjd 148 9,87780
2wDWc 160 9,16562
2wPOJ 158 10,32308
2y3Yr 148 9,50491
2zJ6v 144 10,22709
2zpo1 154 9,19082
35uRP 148 9,69026
3CZMM 148 10,21626
3CzT2 139 10,21239
3E84q 149 9,78090
3EPAR 158 9,07285
3ExdB 141 9,72797
3FcEB 150 9,05595
3HbME 165 9,90539
3HmKO 151 8,82419
3Hmwo 170 9,60845
3IhU5 139 10,29226
3IjnA 146 10,20775
3IqIp 148 10,04309
3JO1G 114 9,82919
3L0Gt 141 9,60220
3LH3m 219 8,31070
3ULSe 173 8,82845
3W6kd 173 8,82845
3aPm0 148 9,64268
3aSft 163 9,52967
3aTGO 162 9,74525
3hJn9 163 9,18908
3ozRM 158 8,77468
42GSR 176 6,50809
43a4L 148 9,35612
46k7N 159 8,04232
4AbZc 160 8,34319
4B6iK 174 6,88442
4Ci6Z 177 8,83676
4DFVd 159 10,43725
4JIYV 141 9,85917
4QOff 140 10,28730
4WHkd 144 9,76317
4XkJc 154 10,26448
4bvyp 171 8,68816
4gc9g 159 7,58411
4lfs3 159 7,57910
4lgnj 168 8,35235
4o1U1 150 5,50727
4pJmL 120 7,51238
4pzux 144 8,56084
4t91H 148 9,80959
4wnER 160 8,02710
4wnkb 158 8,05173
52ETR 161 8,02304
52UW5 153 8,70505
53sRA 177 8,82845
54hv8 154 9,35064
561pz 185 8,66947
56MV3 158 7,42985
58sSP 158 9,18444
59tLg 144 8,57412
5ASHi 134 4,99657
5Av9O 107 8,86913
5BFgM 158 7,42928
5BIX9 199 8,82458
5D1xc 158 7,42928
5I7ev 134 9,75299
5a7L3 143 9,25046
5abJY 153 9,06485
5abpD 158 8,55465
5fCSa 158 8,04741
5ftnz 160 8,68881
5hqln 144 8,56090
5kts6 160 8,54852
5m6yX 161 8,32701
5mO0Z 158 7,43223
5mjZp 142 8,34216
5nUG0 152 9,36437
5nZYh 199 8,83225
5rVmj 144 9,60271
5s3KK 139 9,86374
5tb2W 145 9,22215
5uPag 177 8,83676
5wSXh 158 8,80949
5y6cg 107 5,39677
5ynPP 199 8,70112
5yuwL 123 8,53273
5zxLk 150 5,16794
6Acp1 158 8,04064
6B8Po 157 10,60249
6GMvL 158 8,04741
6GS8H 161 8,02253
6GkAV 160 8,32811
6Gn59 199 8,70795
6GpVy 156 9,79625
6Hhm3 148 6,93699
6IBGH 161 9,08490
6IKIy 161 8,02246
6LBon 160 8,53557
6LDwc 143 8,35886
6LE5b 158 8,04741
6Lxou 150 8,97440
6Mg5e 159 8,10982
6xp60 185 8,79937
6zjnX 144 8,87054
7ChHA 164 9,55320
7DxJ6 154 9,53018
7JduI 187 8,89949
7LA72 133 9,32582
7SABS 169 8,25403
7TdRV 144 9,64242
7Tm84 141 9,87780
7TrpI 140 9,87864
7VFPw 149 10,19975
7W5do 144 8,35886
7Zfmq 176 7,56057
7Znoi 125 9,12481
7oBIs 148 9,83286
80xY6 131 9,46211
83O93 120 7,62389
83bGq 158 8,34319
84Age 162 10,06205
86wcg 151 9,72604
88dce 159 9,05840
890LL 151 9,46707
8Bl9a 143 9,61909
8BleO 157 10,06011
8Bo7b 140 9,87864
8CpKF 148 9,65287
8CvId 138 9,83757
8D2G7 141 10,21432
8DS3Z 106 10,56497
8DnC2 135 8,34719
8E1Se 139 9,19701
8E83Q 149 9,72404
8F8L9 144 9,71908
8FgO7 141 10,46607
8FxLp 138 9,74203
8FxYy 158 8,61402
8G7R1 141 9,83357
8GPa6 144 9,64242
8Gu3y 148 10,14914
8GwjF 151 8,82419
8b7Y3 144 9,46655
8btKS 159 7,58411
8cucM 151 4,69140
8d8Wn 196 9,59975
8dL7N 125 9,12532
8i1mw 125 9,43999
8iySq 199 9,23240
8jPFh 158 9,95148
8mxNN 144 8,35886
8nFVF 146 10,03368
8o1cl 141 9,81030
8oUW8 158 8,81981
8p6mi 147 9,31679
8q8g5 140 8,35538
8sKOx 139 10,34564
8u0Lm 159 10,16488
8vnGV 155 8,69493
8vxz3 151 9,46707
8wv7J 158 8,77468
8xMBk 169 9,66254
8xUNS 155 8,65876
8xUoc 106 11,15440
8zT00 114 9,58582
Aer4 141 6,40447
De0x 145 9,00793
Epz2 141 9,76672
Er6C 160 9,74228
FdZd 144 8,85307
G92f 159 6,49672
VlgV 148 10,04187
Z2aT 105 11,31357
cvjs 142 9,81372
cycl 144 9,73313
jBPo 144 8,56084
jTw6 170 8,69538
liLF 144 9,76259
rGSr 157 10,18254
rGsQ 164 9,59053
xf4p 144 8,72343
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_35700
3Izvq
4 43,9% 148 2.275E-52
2 phalp2_30039
2BcS3
3 43,2% 141 3.669E-47
3 phalp2_30028
2wDMc
38 52,6% 112 6.896E-47
4 phalp2_29884
8cUTh
33 43,4% 129 1.953E-37
5 phalp2_29239
8BGtN
3 53,6% 95 5.295E-31
6 phalp2_29682
17khB
5 38,8% 108 1.235E-29
7 phalp2_26675
2zO6T
1 35,9% 114 3.178E-29
8 phalp2_20878
6OZeF
25 31,5% 152 6.831E-21
9 phalp2_27852
8yUrk
1 29,0% 131 1.152E-19
10 phalp2_31192
80nfC
16 34,2% 114 4.041E-19

Domains

Domains
Representative sequence (used for alignment): 2zxe8 (151 AA)
Member sequence: 19AB3 (160 AA)
1 151 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01464

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2zxe8) rather than this protein.
PDB ID
2zxe8
Method AlphaFoldv2
Resolution 92.34
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50