Protein
- Protein accession
- 7EzG1 [EnVhog]
- Representative
- YxWk
- Source
- EnVhog (cluster: phalp2_17928)
- Protein name
- 7EzG1
- Lysin probability
- 92%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MKQKIKTILQTLMVVTVILFVSGIWYVVSAEKENVKAAELELEMEEVVETLEAITTHTLPNFERENNQTFINSTIACVNYIYNTTSDIYPVNLELLVAQAALESAWGNSRFALEGRNLFGIRTYDLREPHMLPSNNPKKWGVKVYMHECDSVQHYINILNNGTKFEEYRKLKHVQNINDPFKLVMTLDAYASDKHYFDKVKKIIKMLRENYTLN
- Physico‐chemical
properties -
protein length: 214 AA molecular weight: 24900,4 Da isoelectric point: 6,32 hydropathy: -0,27
Representative Protein Details
- Accession
- YxWk
- Protein name
- YxWk
- Sequence length
- 220 AA
- Molecular weight
- 25798,12360 Da
- Isoelectric point
- 5,62464
- Sequence
-
MSISLMTKAKIKSVFYTLIFCMIVAFGFLVNNEYKNAKAAAVEKETEEIVQVLEELNKEWVRPDFERENNQTFINSVAQCVYYIYNTTTDIYPVNMELLVAQAALESGWGNSRFALEGRNLFGIRTYDLREPHMLPSNKPKKWGVKVYEHECDSVQHYIDILNNGTAFEDYRVLKHEKDINDPFQLLVTLDAYATDEHYFDKIRRIIKKLRTDYNIPKEN
Other Proteins in cluster: phalp2_17928
| Total (incl. this protein): 140 | Avg length: 206,4 | Avg pI: 6,37 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| YxWk | 220 | 5,62464 |
| 10aLZ | 196 | 8,61815 |
| 11Z7e | 217 | 5,78339 |
| 1B1ck | 169 | 5,66511 |
| 1Bw8s | 210 | 7,05181 |
| 1C4r5 | 210 | 7,05181 |
| 1CbJ8 | 216 | 5,40285 |
| 1Ce5v | 210 | 7,05260 |
| 1DX5 | 193 | 8,60725 |
| 1EQWR | 210 | 7,05181 |
| 1FeNd | 193 | 9,02810 |
| 1FfR4 | 214 | 5,46441 |
| 1GD3Z | 216 | 5,26758 |
| 1MNQj | 214 | 5,31816 |
| 1RkCC | 196 | 6,51815 |
| 1RxYP | 198 | 8,79279 |
| 1SACa | 196 | 8,61815 |
| 1SqHw | 196 | 8,61815 |
| 1TQC3 | 212 | 5,42030 |
| 1TSdJ | 202 | 6,70441 |
| 1TYhG | 216 | 6,11908 |
| 1TZqr | 212 | 5,16606 |
| 1UHu9 | 194 | 9,12236 |
| 1V5FR | 212 | 5,34442 |
| 1VBPj | 202 | 6,44119 |
| 1VeRa | 196 | 6,07691 |
| 1W94W | 212 | 5,31919 |
| 1WlCp | 196 | 6,30307 |
| 1alpp | 188 | 7,73030 |
| 1gb7u | 196 | 6,07691 |
| 1s8jD | 212 | 5,85035 |
| 1tPOS | 212 | 5,34391 |
| 1ultB | 212 | 5,85938 |
| 1vaT3 | 212 | 5,85944 |
| 1vfPj | 216 | 5,52671 |
| 1w7ey | 198 | 8,30877 |
| 1wsvZ | 216 | 5,99352 |
| 1yv8T | 212 | 5,85035 |
| 22sEE | 213 | 5,76742 |
| 23kvc | 216 | 5,11098 |
| 25Zl2 | 217 | 5,99108 |
| 264rl | 214 | 5,47157 |
| 26AK2 | 205 | 6,58033 |
| 26bTx | 214 | 6,53116 |
| 276f5 | 216 | 5,37040 |
| 276r8 | 199 | 6,57885 |
| 28c51 | 216 | 5,13003 |
| 28cDm | 213 | 5,59810 |
| 28gWi | 214 | 5,44219 |
| 2G0gz | 214 | 6,00097 |
| 2KFdl | 196 | 8,67153 |
| 2NcyZ | 165 | 5,81386 |
| 2PKIU | 216 | 5,38768 |
| 2RPQO | 206 | 6,57294 |
| 2RZqD | 216 | 5,23205 |
| 2TB7h | 216 | 5,30941 |
| 2TBrC | 185 | 8,26950 |
| 2V01h | 214 | 5,88957 |
| 2dIE1 | 214 | 6,08805 |
| 2f9UC | 216 | 5,23205 |
| 2fdsk | 207 | 6,90386 |
| 2hnOn | 210 | 7,05260 |
| 2k7UD | 214 | 6,08799 |
| 2kgDQ | 214 | 6,31535 |
| 2m8xN | 203 | 5,60639 |
| 2nKNx | 216 | 5,12366 |
| 2vEJM | 196 | 8,36608 |
| 2wYIg | 214 | 6,10612 |
| 2yNIa | 216 | 6,09726 |
| 2yZ73 | 214 | 6,10612 |
| 2zVBh | 193 | 7,66624 |
| 2zWDk | 196 | 6,89908 |
| 36flz | 212 | 5,35147 |
| 3969T | 193 | 9,02810 |
| 39UhY | 214 | 6,08805 |
| 3CuLG | 215 | 5,23745 |
| 3FSew | 196 | 7,73570 |
| 3IYMW | 196 | 6,42669 |
| 3bDtX | 216 | 6,32325 |
| 3gtUI | 214 | 6,00336 |
| 3hEs7 | 214 | 4,99282 |
| 3oCSg | 212 | 5,65033 |
| 3oHUj | 213 | 5,46225 |
| 3rBjX | 212 | 4,92359 |
| 3rIfo | 198 | 6,82690 |
| 3ryp5 | 196 | 8,61815 |
| 432pe | 216 | 5,21381 |
| 43gur | 216 | 5,13400 |
| 4Q91C | 197 | 5,71848 |
| 4WRqv | 186 | 7,01299 |
| 4dXS | 158 | 4,82526 |
| 4jlHq | 214 | 5,18664 |
| 4qWQM | 193 | 6,95660 |
| 4t7tT | 198 | 7,64453 |
| 4t9H4 | 193 | 8,37749 |
| 4ubu | 216 | 4,94371 |
| 4weFm | 214 | 5,79851 |
| 5ir5 | 214 | 6,65871 |
| 5qhQL | 212 | 5,23336 |
| 5rN6r | 196 | 5,96738 |
| 5shim | 212 | 5,46538 |
| 5zXHV | 214 | 5,21278 |
| 6CkJJ | 216 | 5,06188 |
| 6V4jK | 216 | 5,66198 |
| 7CXr7 | 214 | 8,25268 |
| 7CY34 | 200 | 6,05627 |
| 7EMUe | 215 | 5,23745 |
| 7EnGl | 217 | 5,48589 |
| 7HphH | 217 | 5,34141 |
| 7Urwk | 217 | 5,60480 |
| 7WlCA | 212 | 5,46538 |
| 7koNV | 214 | 5,90747 |
| 7rpkI | 202 | 6,49712 |
| 82CZe | 214 | 5,29418 |
| 8BFdD | 193 | 8,99419 |
| 8BeLJ | 224 | 5,64408 |
| 8C2FF | 214 | 5,99739 |
| 8CIRc | 214 | 5,79851 |
| 8EDQG | 196 | 6,30307 |
| 8EIDH | 217 | 5,60480 |
| 8EOP8 | 185 | 5,36415 |
| 8EwOF | 196 | 8,61815 |
| 8aAku | 212 | 5,20301 |
| 8adxi | 196 | 8,61815 |
| 8awEj | 212 | 5,19204 |
| 8gIGP | 214 | 5,20505 |
| 8ijM5 | 202 | 7,00787 |
| 8wXuW | 199 | 6,30847 |
| 8waME | 198 | 6,82690 |
| 8x3Bh | 193 | 8,97008 |
| 8xbjT | 193 | 8,60725 |
| 8zJ8k | 214 | 5,20505 |
| AHyT | 210 | 7,10427 |
| WIQg | 193 | 8,61738 |
| XokS | 196 | 8,36763 |
| Y1qF | 214 | 5,79851 |
| poGH | 212 | 5,62543 |
| tKjk | 193 | 8,59900 |
| wDle | 195 | 7,73007 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_2807
8wEtz
|
388 | 50,5% | 184 | 7.911E-57 |
| 2 |
phalp2_27854
8z2UL
|
887 | 39,1% | 202 | 2.521E-46 |
| 3 |
phalp2_34258
3dxLm
|
725 | 46,4% | 153 | 3.423E-43 |
| 4 |
phalp2_9899
2Cydi
|
49 | 46,4% | 142 | 1.580E-36 |
| 5 |
phalp2_11429
8zF3P
|
9 | 31,1% | 154 | 7.451E-21 |
| 6 |
phalp2_4384
2huub
|
3 | 31,7% | 148 | 2.863E-13 |
| 7 |
phalp2_28570
7ZKcc
|
2 | 26,8% | 212 | 8.606E-08 |
| 8 |
phalp2_28108
7xE0g
|
17 | 31,2% | 144 | 3.113E-05 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(YxWk)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50