Protein
- Protein accession
- 7DmsG [EnVhog]
- Representative
- 7IU6z
- Source
- EnVhog (cluster: phalp2_37898)
- Protein name
- 7DmsG
- Lysin probability
- 98%
- PhaLP type
-
VAL
Probability: 59% (predicted by ML model) - Protein sequence
-
MRYLSNPDIAYYARKAGFSGDLVPVMVAIANAESGRDRLALNPNAATGDESYGLTQINMLGKMGPERRKLFGIKSNEELYDPETNLKAAKKIYDKQGLNAWSVYRSGAYKPFLDDSIQASNLDGGIDKTQLELGKYEIDTGKEVALESQNKREEAMKSALMFKMIQNQLQQPSMIEQLIEEPLSMPNMGGLMPPDMPV
- Physico‐chemical
properties -
protein length: 198 AA molecular weight: 22002,9 Da isoelectric point: 5,07 hydropathy: -0,52
Representative Protein Details
- Accession
- 7IU6z
- Protein name
- 7IU6z
- Sequence length
- 198 AA
- Molecular weight
- 22339,72510 Da
- Isoelectric point
- 5,33561
- Sequence
-
MTSPSYVTKKQLAESLLKAGFSPQELPTMIEIARRESGFNRLALNPDASTGDLSYGTFQINMIGDMGPERRKQFGIEKNEQLYDLDTNTRAAKIIRDQQGFGAWSVYDPTDPAFTNVNLDDTTAKQAGDTYNITVEAQKQKARNPEKEFEQLMLGRLLNNSLKSTPSDYDFGKLLQTLTNQSKRDAARLMQSYDTFYP
Other Proteins in cluster: phalp2_37898
| Total (incl. this protein): 15 | Avg length: 198,7 | Avg pI: 6,16 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7IU6z | 198 | 5,33561 |
| 1rT5o | 195 | 8,62924 |
| 1yU6q | 198 | 5,33948 |
| 2xAH9 | 198 | 5,33561 |
| 3DHY2 | 198 | 5,33561 |
| 3DVTF | 196 | 7,81971 |
| 3EBAn | 198 | 5,19965 |
| 3GzAw | 198 | 6,61693 |
| 3LbJo | 202 | 4,97281 |
| 3rIJx | 198 | 7,80985 |
| 4S4Sl | 196 | 6,36667 |
| 4ZkR | 195 | 5,65647 |
| 7TkXL | 210 | 7,84098 |
| 87Fmm | 202 | 5,09013 |
Similar Clusters
No similar clusters were found for representative 7IU6z.
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7IU6z)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50