Protein
- Protein accession
- 7DM8m [EnVhog]
- Representative
- qevc
- Source
- EnVhog (cluster: phalp2_12448)
- Protein name
- 7DM8m
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MENDIRIDRTKLHPYLDYMLGRLLKYSNKEGIYLIITEGYRTVEKQNELYAQGRTTGVSGQTVTNAKGTDYESQHQWGIAFDIAIKNTGHTWDYAYFKKVADIAKKYCKALGWGGDWIGYPDNPHFYLKKWGSTTYSLKKQYVIPANFTKTWQKTVKGTKKGLSIRNKTRTKVLLKKQPNGTVFDVLWQHRIWSKVRCNGVVGYSLTRFLK
- Physico‐chemical
properties -
protein length: 211 AA molecular weight: 24505,9 Da isoelectric point: 9,86 hydropathy: -0,65
Representative Protein Details
- Accession
- qevc
- Protein name
- qevc
- Sequence length
- 234 AA
- Molecular weight
- 27129,74950 Da
- Isoelectric point
- 10,23921
- Sequence
-
MKKQHDVRIDRSKLHPWLDYKLTVLLKKCAKKGIYLIITEGFRTKEHQDRLYAKGRTKPGKVVTNAKGSTYSSQHMWGIAFDIAIQYKKDLYDINTIKKVAKIAKSIGLGWGGDWKTIVDTPHFYLPKWGSTTTELKKIYKTPDMFRKSWAKKVTRDKGLLLWKATTKLTGSYLRIPKSAKVEVLFVKTDKWYAKVRYKGKVGHNKKKKIAVKKRRAFLVGYSFEARCENAGIR
Other Proteins in cluster: phalp2_12448
| Total (incl. this protein): 108 | Avg length: 213,6 | Avg pI: 10,07 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| qevc | 234 | 10,23921 |
| 23qU2 | 216 | 9,94265 |
| 3VHBE | 215 | 10,02582 |
| 3WAKz | 216 | 10,15230 |
| 3ZrOh | 206 | 9,92189 |
| 3kSm6 | 211 | 9,94820 |
| 3kWwk | 219 | 9,98359 |
| 3kYSI | 219 | 9,95026 |
| 3kZnG | 212 | 10,00422 |
| 3khfY | 211 | 10,33636 |
| 3l5EZ | 219 | 9,91951 |
| 3lmi3 | 211 | 10,09390 |
| 3macx | 219 | 10,00106 |
| 3qB5l | 219 | 9,96805 |
| 3sNWa | 212 | 10,03916 |
| 3sUOs | 219 | 9,88669 |
| 3sbis | 211 | 10,07269 |
| 3sp0f | 219 | 9,95052 |
| 3svUk | 219 | 9,95207 |
| 3t7MW | 211 | 10,02053 |
| 3trUw | 211 | 10,15282 |
| 3uHBB | 209 | 10,05302 |
| 3uHam | 209 | 10,05521 |
| 3xa4n | 211 | 10,15282 |
| 3yBZY | 209 | 9,96612 |
| 3yjm4 | 211 | 10,24346 |
| 4LaGy | 215 | 9,80301 |
| 4f809 | 207 | 9,99745 |
| 5JWhP | 211 | 10,08158 |
| 5LIrV | 211 | 9,96644 |
| 5NUpy | 210 | 10,07810 |
| 5PTDq | 219 | 9,98456 |
| 5PvYz | 211 | 10,33636 |
| 5QI54 | 209 | 10,04187 |
| 5RBY2 | 211 | 10,30935 |
| 5REXn | 219 | 9,93698 |
| 5SQ2m | 210 | 10,05676 |
| 5Sc9K | 211 | 10,36511 |
| 5SoLJ | 209 | 10,04187 |
| 5TH0j | 219 | 9,98456 |
| 5TOHy | 219 | 10,01692 |
| 5TdyT | 211 | 10,30935 |
| 5VdAb | 211 | 9,98456 |
| 5WKXL | 209 | 10,00390 |
| 5XKAN | 219 | 9,93698 |
| 5YT3z | 210 | 10,03736 |
| 5ZTjS | 219 | 10,01692 |
| 60LQM | 210 | 10,07759 |
| 60mIv | 211 | 10,34900 |
| 60zUC | 211 | 10,13341 |
| 61BjX | 211 | 10,36415 |
| 61sAc | 209 | 10,08062 |
| 63012 | 219 | 9,91951 |
| 63UCX | 211 | 10,33430 |
| 64IFo | 211 | 10,30903 |
| 661iS | 209 | 10,04045 |
| 67KN2 | 219 | 9,96831 |
| 67LVj | 211 | 10,15282 |
| 68vGq | 212 | 10,14599 |
| 6YrOX | 210 | 10,13058 |
| 6aYG4 | 223 | 10,00274 |
| 6anpd | 210 | 10,03626 |
| 6cqIW | 211 | 10,11975 |
| 6doJc | 189 | 10,14044 |
| 6dxrt | 219 | 9,95052 |
| 6ebxo | 210 | 10,07165 |
| 6fOb4 | 211 | 9,98295 |
| 6fUUW | 219 | 9,96805 |
| 6fqGm | 209 | 10,48225 |
| 6g2Xd | 211 | 10,28459 |
| 6g6am | 211 | 10,10427 |
| 6gqeQ | 211 | 10,07230 |
| 6jMBw | 211 | 10,15282 |
| 6jMP0 | 209 | 9,98359 |
| 6jOEX | 219 | 9,98488 |
| 6jyoC | 211 | 10,19763 |
| 6k41h | 211 | 10,34900 |
| 6kErv | 211 | 10,28208 |
| 6kNCj | 211 | 10,35209 |
| 6lLCx | 210 | 10,02736 |
| 6m59i | 209 | 10,08062 |
| 6mDCa | 190 | 9,94085 |
| 6mrAC | 219 | 9,88250 |
| 6nDZU | 233 | 10,17693 |
| 6np7R | 209 | 10,07713 |
| 6oOYR | 210 | 10,02079 |
| 6ov1D | 219 | 9,95052 |
| 6p3tm | 211 | 10,03516 |
| 6q1I1 | 209 | 10,02266 |
| 6r870 | 211 | 10,03516 |
| 6s8AT | 219 | 10,01763 |
| 6uSpM | 214 | 9,96805 |
| 6vOtN | 274 | 9,70805 |
| 7QJbR | 209 | 10,02304 |
| 7sJQH | 209 | 10,04380 |
| 7t6vv | 219 | 9,96773 |
| 7tDUV | 219 | 9,79947 |
| 8614j | 214 | 10,03549 |
| 86eIp | 219 | 9,96805 |
| 8cx7p | 211 | 10,08197 |
| 8fsOf | 211 | 10,20497 |
| 8mPis | 211 | 10,29704 |
| EBj1 | 219 | 10,00074 |
| KIlA | 211 | 10,29633 |
| Nmst | 219 | 10,00048 |
| OlqH | 219 | 10,01763 |
| a1uS | 215 | 10,23173 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1844
3xTtn
|
8 | 40,5% | 227 | 9.129E-62 |
| 2 |
phalp2_2874
ol4j
|
82 | 55,4% | 146 | 8.237E-61 |
| 3 |
phalp2_29857
41cMd
|
95 | 50,0% | 144 | 2.114E-51 |
| 4 |
phalp2_33303
6crLy
|
183 | 39,1% | 202 | 1.532E-48 |
| 5 |
phalp2_34371
4aKCB
|
348 | 46,1% | 143 | 1.105E-29 |
| 6 |
phalp2_27726
6US3d
|
23 | 40,1% | 152 | 3.518E-26 |
| 7 |
phalp2_2393
7PQjE
|
101 | 27,6% | 206 | 5.943E-21 |
| 8 |
phalp2_12425
iId9
|
7 | 33,5% | 152 | 6.861E-18 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(qevc)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50