Protein
- Protein accession
- 7CCs1 [EnVhog]
- Representative
- 1rFir
- Source
- EnVhog (cluster: phalp2_1418)
- Protein name
- 7CCs1
- Lysin probability
- 95%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MLPEWLHFKLVDHAFAIVKSSWSMWAQYAAFYFIVVPEIMYRFFGIDSDPVVVWWAAAICVFIGIVGRIKDQQLKDPKRVAWSRRIGLMILIGGVAFATATMVRAAPASDEAFLQEAVPLIAKWEGKRNCAYFDVVGVPTIGYGHTRTVTAADVNNGVCWSDEKVTQLLSDEILEYRHELHKYFLPNTLDNLLPAPRDAAYTSLAFNIGWHRAGTSTASKRLNRGDIAGGCRAIGRWNRAGGRVWRGLTNRRAEETSKCMKGLV
- Physico‐chemical
properties -
protein length: 264 AA molecular weight: 29608,9 Da isoelectric point: 9,33 hydropathy: 0,02
Representative Protein Details
- Accession
- 1rFir
- Protein name
- 1rFir
- Sequence length
- 257 AA
- Molecular weight
- 28004,55440 Da
- Isoelectric point
- 9,72307
- Sequence
-
MKPELVEDVARIVKISWSFWAQIAGLILLMGGEVLYALTGIDFDPRITGYAGIGLLIFGIVARAFKQTGSTLRNWMRFLAVVIVIVMASIVAVQAKTPGQCDTPCVASQAQTMTILLPLVQKWEGTRLVAYRDVVGIPTICTGSTRGVKMGMTKTQAECDALLRSELIEYRAAVQRGFSVETITYRLPPERDAAFADLGYNVGPPTVRTSTATRRLNAGNVPGACVAIGWFNKAGGRIWRGIVLRRNDDRALCRVGL
Other Proteins in cluster: phalp2_1418
| Total (incl. this protein): 138 | Avg length: 263,2 | Avg pI: 9,27 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1rFir | 257 | 9,72307 |
| 13gfK | 255 | 9,88818 |
| 14aDe | 199 | 9,92351 |
| 1aj2E | 262 | 8,39870 |
| 1alqC | 262 | 8,39876 |
| 1djNb | 257 | 9,38468 |
| 1rM9o | 265 | 9,53386 |
| 1suMq | 299 | 9,07974 |
| 21Z50 | 263 | 9,78780 |
| 2925M | 272 | 8,59707 |
| 2927j | 299 | 8,54936 |
| 2AVza | 266 | 5,77117 |
| 2If1I | 294 | 7,58359 |
| 2TcAE | 259 | 9,98088 |
| 2TczJ | 248 | 9,14756 |
| 2UqLm | 299 | 8,54936 |
| 2cr97 | 259 | 9,93440 |
| 2tu26 | 223 | 9,67401 |
| 30DRO | 248 | 9,39590 |
| 34CHG | 256 | 8,55097 |
| 35ibo | 248 | 9,39622 |
| 35juX | 232 | 9,34729 |
| 3B6NS | 299 | 8,75721 |
| 3EQd | 247 | 9,55404 |
| 3EpE8 | 250 | 9,79631 |
| 3Prhd | 269 | 6,18877 |
| 3PuL | 284 | 9,58253 |
| 3Vej7 | 267 | 8,37549 |
| 3Y9bi | 245 | 8,92792 |
| 3Z180 | 236 | 9,81191 |
| 3bKYZ | 264 | 8,19627 |
| 3mJQm | 299 | 8,76752 |
| 3mLXY | 265 | 8,25674 |
| 45EvJ | 273 | 6,73755 |
| 45Pel | 265 | 8,69074 |
| 4Bo8n | 271 | 5,98579 |
| 4PwgT | 243 | 9,09470 |
| 4QBE5 | 276 | 9,93015 |
| 4QC69 | 262 | 9,75866 |
| 4QE3Q | 268 | 9,74938 |
| 4QEEM | 259 | 9,93440 |
| 4QEKB | 231 | 9,63772 |
| 4TZ9v | 254 | 9,80682 |
| 4UXId | 252 | 10,05586 |
| 4UlMS | 273 | 8,93778 |
| 4Un6E | 261 | 9,11256 |
| 4UtkH | 253 | 9,84769 |
| 4V4mn | 229 | 9,20629 |
| 4W0BV | 272 | 8,83309 |
| 4Wfoh | 255 | 9,84595 |
| 4dZiy | 275 | 10,00847 |
| 4e0il | 264 | 9,81874 |
| 4kTOJ | 290 | 8,86719 |
| 4ueO7 | 270 | 9,82003 |
| 4xiWX | 292 | 9,02675 |
| 5I9eX | 284 | 9,64404 |
| 5ry9N | 249 | 9,62508 |
| 5sA4S | 282 | 8,81761 |
| 5sJ4B | 268 | 9,63681 |
| 5sKRs | 253 | 9,96431 |
| 5sKhU | 272 | 8,97743 |
| 65Dd | 252 | 9,04989 |
| 6G9oI | 292 | 9,61225 |
| 6G9xR | 282 | 9,47268 |
| 6PQgJ | 263 | 9,94601 |
| 71YqZ | 244 | 10,09602 |
| 72dO3 | 252 | 9,80314 |
| 75SjX | 291 | 9,36695 |
| 79FIM | 291 | 9,22673 |
| 79FJJ | 250 | 9,80179 |
| 7BTyb | 263 | 9,34845 |
| 7BaEn | 299 | 8,94990 |
| 7BaFh | 299 | 8,54079 |
| 7QtAH | 253 | 10,52654 |
| 7b67n | 272 | 9,38474 |
| 7cJKD | 276 | 9,99726 |
| 7cMux | 256 | 9,38461 |
| 7d33t | 276 | 9,02179 |
| 7dMS | 249 | 9,38951 |
| 7dNc | 257 | 9,82319 |
| 7dNj4 | 276 | 9,17928 |
| 7eG5 | 271 | 7,57348 |
| 7ffjI | 279 | 9,79676 |
| 7ffmb | 273 | 9,83422 |
| 7gALC | 276 | 8,60661 |
| 7gOQV | 253 | 10,14457 |
| 7i6Z | 276 | 7,66328 |
| 7i6s | 271 | 7,57348 |
| 7i7As | 314 | 9,74789 |
| 7l1Kk | 248 | 8,46459 |
| 7lrjH | 277 | 8,55910 |
| 7mcm | 275 | 8,71769 |
| 7mifa | 282 | 9,44393 |
| 7oqGB | 254 | 9,87335 |
| 7pn0y | 256 | 9,56687 |
| 7prcu | 256 | 9,46855 |
| 7prry | 256 | 9,42194 |
| 7prvI | 256 | 9,78464 |
| 7r3lI | 276 | 8,83773 |
| 7rK0S | 253 | 9,77046 |
| 7ra8L | 248 | 9,27392 |
| 7raB6 | 259 | 9,89430 |
| 7rak1 | 254 | 10,07423 |
| 7rwW1 | 261 | 9,29642 |
| 7s812 | 252 | 9,47597 |
| 7sFrL | 254 | 9,53418 |
| 7sK4u | 267 | 9,74544 |
| 7sUbb | 255 | 9,56777 |
| 7se2V | 231 | 9,63727 |
| 7skhu | 253 | 9,77394 |
| 7smoK | 267 | 10,35396 |
| 7srrK | 282 | 8,98485 |
| 7ssB6 | 259 | 10,06779 |
| 7suWR | 254 | 9,53283 |
| 7svss | 254 | 9,43052 |
| 7vLhg | 250 | 9,47068 |
| 7vNeu | 253 | 9,97276 |
| 7vXqV | 271 | 6,96439 |
| 7w2J5 | 250 | 9,91564 |
| 7w7sN | 274 | 8,89646 |
| 7xQtP | 277 | 9,80907 |
| 7xSlS | 265 | 8,97801 |
| 7xgE0 | 262 | 9,41098 |
| 7yiMV | 250 | 9,53470 |
| 7zwLV | 255 | 9,65113 |
| 80kG5 | 246 | 9,79805 |
| 8qAf5 | 255 | 9,85710 |
| 8wTI3 | 265 | 9,33846 |
| VUC7 | 250 | 8,77133 |
| W2Xx | 249 | 9,78400 |
| Wz4j | 282 | 9,46404 |
| X3uE | 249 | 8,86816 |
| eORs | 249 | 9,94794 |
| gAMT | 271 | 9,75834 |
| i9PS | 255 | 9,92331 |
| jDlm | 251 | 9,72643 |
| l3LT | 236 | 9,85717 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_306
6N02T
|
5 | 26,9% | 282 | 4.991E-40 |
| 2 |
phalp2_16574
7xiDE
|
15 | 28,9% | 266 | 1.125E-38 |
| 3 |
phalp2_8851
2IyxA
|
73 | 34,7% | 167 | 1.443E-35 |
| 4 |
phalp2_22286
7A6Fj
|
714 | 32,7% | 168 | 3.642E-28 |
| 5 |
phalp2_21229
1fv51
|
17 | 31,6% | 177 | 4.299E-27 |
| 6 |
phalp2_8169
6Xyoc
|
32 | 32,3% | 170 | 5.852E-27 |
| 7 |
phalp2_37804
4EicH
|
34 | 28,3% | 187 | 4.296E-21 |
| 8 |
phalp2_15055
7rwX8
|
6 | 30,6% | 183 | 3.064E-19 |
| 9 |
phalp2_30186
3R0K4
|
1 | 24,8% | 165 | 4.714E-18 |
| 10 |
phalp2_34395
4g6xF
|
2 | 25,7% | 163 | 6.376E-12 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1rFir)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50