Protein
- Protein accession
- 7ATp6 [EnVhog]
- Representative
- 3zJio
- Source
- EnVhog (cluster: phalp2_14292)
- Protein name
- 7ATp6
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAFLDTIAVSEIGSALLAKSDDGYNVLVGSTASRPLLFSSYAAHPNALNRQIPVPSTAAGRYQILTRWWRIYQAQMKLADFGPISQDRYALQQLREHGALALIDAGRFREAVAKVSNVWASLPGAGYGQHENKIEHLLAAYRAAGGEVVA
- Physico‐chemical
properties -
protein length: 150 AA molecular weight: 16268,3 Da isoelectric point: 9,00 hydropathy: -0,03
Representative Protein Details
- Accession
- 3zJio
- Protein name
- 3zJio
- Sequence length
- 167 AA
- Molecular weight
- 17904,83340 Da
- Isoelectric point
- 5,26871
- Sequence
-
VTRFAFPAGLAGAQSSAFLNMTAISEIGPALLANSDDGYNVLVGSTAQHPILFSDYSQHPHILNHSLDSTAAGRYQFIWPTWQSAAKALGLTDFSPESQDRACVWLLQQCGAYLPLIQGDFDAAVMHASTQWASLPGSKAGQHVNSWIALYDVFTKDGGVSLCTEKS
Other Proteins in cluster: phalp2_14292
| Total (incl. this protein): 170 | Avg length: 164,5 | Avg pI: 7,88 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3zJio | 167 | 5,26871 |
| 16fRT | 163 | 8,76243 |
| 1Ih9c | 167 | 6,56942 |
| 1d5NT | 166 | 6,89567 |
| 1fwr8 | 170 | 6,17990 |
| 1hSlv | 164 | 9,74415 |
| 1hkmb | 164 | 9,68987 |
| 1jWyp | 164 | 9,34136 |
| 1lJRK | 153 | 6,17024 |
| 1lNVu | 181 | 6,05883 |
| 1oppt | 164 | 5,38933 |
| 1ox3E | 166 | 6,99457 |
| 1ox5Q | 160 | 5,20238 |
| 1qlSE | 159 | 9,48390 |
| 258I0 | 164 | 5,38387 |
| 28z2J | 164 | 5,90753 |
| 2AXU3 | 164 | 9,41053 |
| 2HTWV | 171 | 9,23318 |
| 2SKU4 | 162 | 5,20636 |
| 2SdNz | 162 | 5,20636 |
| 2Sqb8 | 151 | 5,35391 |
| 2WS65 | 164 | 8,02356 |
| 2Y84d | 164 | 9,39067 |
| 2aDHd | 164 | 9,34284 |
| 2sAF8 | 153 | 6,57823 |
| 2sRQc | 152 | 7,73104 |
| 31Udb | 235 | 5,10030 |
| 35LR4 | 171 | 9,25381 |
| 35W1h | 159 | 5,45662 |
| 3Ax9Z | 153 | 4,79740 |
| 3Llqd | 164 | 5,88309 |
| 3OoJv | 227 | 4,98031 |
| 3aLuj | 153 | 6,19439 |
| 3f4Ow | 157 | 4,80587 |
| 3xCqV | 158 | 7,79927 |
| 4DZUn | 175 | 6,69253 |
| 4FblP | 169 | 5,75696 |
| 4I251 | 172 | 5,08342 |
| 4K1Vp | 157 | 5,07785 |
| 4KM38 | 185 | 7,60173 |
| 4KUtv | 158 | 4,54203 |
| 4ONee | 154 | 5,19221 |
| 4PxuO | 185 | 8,78364 |
| 4dNHX | 151 | 5,90684 |
| 4dSDK | 140 | 5,50124 |
| 4wdr6 | 178 | 6,28562 |
| 5BBCq | 174 | 5,93646 |
| 5BCxR | 167 | 5,92634 |
| 5BEIX | 166 | 9,56525 |
| 5Bd6x | 118 | 5,03039 |
| 5F5w1 | 165 | 6,03911 |
| 5tgpd | 174 | 5,62759 |
| 5yNsM | 167 | 6,45665 |
| 5z0af | 166 | 6,27658 |
| 5z1DQ | 166 | 6,50024 |
| 5z33Z | 164 | 9,39080 |
| 6HwWM | 158 | 5,54256 |
| 6Lf6I | 174 | 5,80095 |
| 6Mvb9 | 164 | 9,11320 |
| 6NsLT | 162 | 5,55507 |
| 6QQry | 159 | 6,88595 |
| 6RXWc | 155 | 8,53215 |
| 6SSLG | 163 | 7,67465 |
| 6STrj | 164 | 8,73187 |
| 6Sdg0 | 164 | 9,34149 |
| 6SjuA | 166 | 9,56448 |
| 6Txa2 | 179 | 5,82034 |
| 6XKK0 | 164 | 7,01361 |
| 6XTY3 | 164 | 5,56274 |
| 6Y1HF | 153 | 5,91094 |
| 6Y4PB | 166 | 6,94626 |
| 740WP | 164 | 9,56525 |
| 740YM | 164 | 9,39080 |
| 740Zu | 164 | 9,39080 |
| 78OYh | 164 | 9,74596 |
| 7Bdpe | 166 | 9,29655 |
| 7PsPX | 164 | 9,16355 |
| 7RrQh | 164 | 9,56525 |
| 7c5CB | 164 | 9,68910 |
| 7cK4l | 171 | 5,80090 |
| 7dgvl | 164 | 9,39080 |
| 7dp0W | 164 | 9,74506 |
| 7elcj | 164 | 9,00045 |
| 7f4pW | 164 | 9,56525 |
| 7hWvQ | 164 | 9,56525 |
| 7iTrp | 164 | 9,34090 |
| 7kSZB | 164 | 9,56525 |
| 7lF4G | 165 | 8,88047 |
| 7lOlR | 164 | 9,68910 |
| 7nNBJ | 164 | 9,34090 |
| 7nNN6 | 164 | 9,34149 |
| 7nNSQ | 164 | 9,45637 |
| 7nNfB | 164 | 9,62063 |
| 7nNvz | 164 | 9,34090 |
| 7nNzk | 164 | 9,74506 |
| 7nOFT | 164 | 9,51607 |
| 7nOwv | 164 | 9,74602 |
| 7nP2d | 164 | 9,34078 |
| 7nPnK | 164 | 9,39016 |
| 7nPtU | 164 | 9,80695 |
| 7nPxv | 164 | 9,34090 |
| 7nQ11 | 164 | 9,00051 |
| 7nQbd | 164 | 9,04448 |
| 7nQkX | 163 | 9,34149 |
| 7px4H | 164 | 9,34071 |
| 7pxB7 | 164 | 9,68910 |
| 7pxcK | 164 | 8,96015 |
| 7pxhz | 164 | 9,00000 |
| 7pxiQ | 164 | 9,39080 |
| 7pxlK | 164 | 9,56525 |
| 7qKMN | 163 | 9,00141 |
| 7qL54 | 163 | 9,00141 |
| 7qLNF | 163 | 9,00141 |
| 7qLaU | 163 | 9,34207 |
| 7qM12 | 164 | 9,34078 |
| 7qM1U | 163 | 8,04000 |
| 7qMD4 | 164 | 9,34090 |
| 7qMIL | 163 | 9,00141 |
| 7qMiR | 163 | 9,34207 |
| 7qMwZ | 163 | 9,00141 |
| 7qN5o | 163 | 9,29720 |
| 7qNLp | 163 | 8,04000 |
| 7qWCA | 164 | 8,00377 |
| 7r4SE | 164 | 9,16355 |
| 7r4WH | 166 | 9,00135 |
| 7r5Cz | 164 | 9,39003 |
| 7r5ju | 164 | 9,04448 |
| 7r5sb | 164 | 9,62063 |
| 7r65q | 164 | 9,20210 |
| 7r68o | 164 | 9,39080 |
| 7r69W | 164 | 9,44638 |
| 7r6cg | 164 | 9,34090 |
| 7r7Ik | 164 | 9,68987 |
| 7u3zK | 164 | 9,29591 |
| 7vPVF | 142 | 9,39396 |
| 7vdmm | 150 | 7,08011 |
| 7wLjF | 164 | 9,56525 |
| 7wLji | 164 | 9,62063 |
| 7xKLD | 159 | 9,56693 |
| 7xKt5 | 164 | 9,68910 |
| 7xoE9 | 164 | 9,34078 |
| 7xoOX | 164 | 8,04425 |
| 7yhDz | 164 | 9,34071 |
| 7yhGP | 164 | 9,34071 |
| 7yhfa | 145 | 8,04000 |
| 7z53C | 142 | 9,34471 |
| 7z54t | 164 | 9,62063 |
| 7z56T | 164 | 8,04399 |
| 7zdqG | 164 | 9,56525 |
| 8218e | 225 | 4,94587 |
| 86ZEx | 163 | 6,19655 |
| 86ZTl | 167 | 5,27872 |
| 86Zaj | 159 | 6,01279 |
| 86mJX | 153 | 5,72297 |
| 871FC | 161 | 5,74366 |
| 871SR | 159 | 5,93146 |
| 874uf | 153 | 4,63217 |
| 87Yk4 | 175 | 5,15396 |
| 8i6I3 | 154 | 5,88746 |
| 8rTaU | 234 | 5,04801 |
| S3Qt | 160 | 7,00998 |
| YoLZ | 180 | 6,28062 |
| ZsYX | 169 | 9,25974 |
| bnE0 | 164 | 6,95183 |
| fMoE | 151 | 6,01598 |
| gCAu | 169 | 9,38739 |
| gTX2 | 164 | 9,68910 |
| hrfv | 167 | 5,67909 |
| D6QWN6 | 159 | 8,49166 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_8549
1DMQs
|
2433 | 40,9% | 166 | 4.226E-61 |
| 2 |
phalp2_14090
8oyxl
|
17 | 43,0% | 151 | 1.492E-60 |
| 3 |
phalp2_15310
1iZB6
|
260 | 42,7% | 159 | 2.110E-57 |
| 4 |
phalp2_22274
7tL4I
|
47 | 37,5% | 165 | 7.450E-57 |
| 5 |
phalp2_4748
7I1R1
|
83 | 36,3% | 157 | 1.311E-52 |
| 6 |
phalp2_34051
89Glt
|
18 | 38,1% | 165 | 9.619E-40 |
| 7 |
phalp2_10185
wALc
|
11 | 35,2% | 156 | 3.814E-37 |
| 8 |
phalp2_29942
8nkTU
|
3 | 35,0% | 160 | 8.879E-36 |
| 9 |
phalp2_32587
1KJKQ
|
2 | 37,3% | 126 | 1.216E-35 |
| 10 |
phalp2_25045
15ncl
|
14 | 32,4% | 157 | 9.116E-27 |
Domains
Domains
1
167 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3zJio)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50