Protein
- Protein accession
- 75Xgv [EnVhog]
- Representative
- 1oDTV
- Source
- EnVhog (cluster: phalp2_31010)
- Protein name
- 75Xgv
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MTDPRKAAFDAVRAIARPGLFDDPGNVHALDNLLDAFGAPRMSETSSIPDDYWPMLSKIESGDRPYIKASTSSASGLYQFIRATWIGEGGSWGSNMNLAFGGLKPPVSEQLARAKTFTEKNAAALRAKGIPINKASLYAAHFFGAGTAAKVIAADVDDRADAIAGEAATKANPSILKGKTVGQFLTWLHGKTGAWAR
- Physico‐chemical
properties -
protein length: 197 AA molecular weight: 20868,4 Da isoelectric point: 9,33 hydropathy: -0,20
Representative Protein Details
- Accession
- 1oDTV
- Protein name
- 1oDTV
- Sequence length
- 131 AA
- Molecular weight
- 14249,88870 Da
- Isoelectric point
- 10,06476
- Sequence
-
SKESGGNFKAKNSLSTATGGFQWLDGTWASMVKNHPDLGLTMDGRGNEAQERRAMRRFTEDNIKHLNRYNIPINNASVYAAHFLGPGGASSVLTKDDSVSLSNLLSPAVLKANPILRNMTVGGFKNWASKR
Other Proteins in cluster: phalp2_31010
| Total (incl. this protein): 130 | Avg length: 196,2 | Avg pI: 9,27 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1oDTV | 131 | 10,06476 |
| 13hnQ | 241 | 9,89114 |
| 1KTNQ | 153 | 10,10099 |
| 1KWKK | 194 | 9,51619 |
| 1MjfQ | 197 | 9,51845 |
| 1a3xX | 196 | 9,52045 |
| 1eX9U | 197 | 9,42368 |
| 1eZbW | 197 | 9,42368 |
| 1f6KY | 195 | 9,09612 |
| 1kHEP | 196 | 9,27089 |
| 1klHA | 207 | 9,54746 |
| 1lLKx | 196 | 6,97269 |
| 1lvof | 197 | 9,51768 |
| 1mrKC | 240 | 9,57860 |
| 1mrvp | 199 | 9,07052 |
| 1mrw8 | 201 | 9,09644 |
| 1msYo | 195 | 9,39596 |
| 1mxQ9 | 197 | 9,45295 |
| 1mxSh | 197 | 9,54914 |
| 1nMcr | 240 | 9,48454 |
| 1qOYU | 198 | 9,58086 |
| 1qPba | 197 | 9,52026 |
| 1qQMA | 200 | 9,69432 |
| 1qQkM | 200 | 9,59601 |
| 1qnZ2 | 201 | 9,39622 |
| 1r2m1 | 187 | 9,32917 |
| 1r3on | 187 | 9,29952 |
| 1rHjk | 193 | 9,51987 |
| 1rJvv | 178 | 9,54765 |
| 1rkeY | 199 | 8,72981 |
| 1slY9 | 202 | 9,24717 |
| 1soqi | 180 | 10,10486 |
| 2CaZH | 196 | 6,41794 |
| 2SPgE | 157 | 9,80069 |
| 2SfoL | 156 | 9,61812 |
| 2fMcc | 202 | 9,09534 |
| 2g7bs | 190 | 9,25613 |
| 2gaZz | 198 | 9,48519 |
| 2gccj | 198 | 9,39532 |
| 2gpXY | 200 | 9,46675 |
| 2hlts | 198 | 9,65229 |
| 2prvy | 249 | 8,98768 |
| 2psks | 166 | 6,70253 |
| 38PLT | 154 | 10,10099 |
| 3KIrB | 197 | 6,84219 |
| 3MyiS | 196 | 9,29861 |
| 3YSsF | 240 | 9,63520 |
| 3dIM0 | 198 | 9,44173 |
| 3e5a4 | 199 | 9,58131 |
| 42H3M | 237 | 9,39364 |
| 42NPH | 171 | 7,78799 |
| 42zgD | 198 | 9,54869 |
| 4BGXi | 224 | 9,77194 |
| 4CN0J | 191 | 9,12571 |
| 4DH1G | 207 | 9,48357 |
| 4KEUB | 156 | 9,55868 |
| 4Lomz | 206 | 5,58741 |
| 4MBXC | 187 | 6,73067 |
| 4MHNw | 185 | 5,43531 |
| 4UDwn | 206 | 9,81320 |
| 4c9QY | 198 | 9,69123 |
| 4e13o | 191 | 9,29900 |
| 4f38E | 206 | 10,04787 |
| 4f3dd | 214 | 9,84015 |
| 4f3nz | 201 | 7,88901 |
| 4f6Zp | 206 | 10,04928 |
| 4gE1v | 206 | 9,91996 |
| 4gHMO | 206 | 9,68278 |
| 4mxoJ | 102 | 9,84685 |
| 4nNDS | 203 | 9,69335 |
| 4vE5N | 201 | 9,42330 |
| 59RUc | 200 | 9,86961 |
| 5BmRo | 178 | 9,42168 |
| 5F0FR | 202 | 9,12358 |
| 5IX5j | 202 | 10,24830 |
| 5IZ7f | 205 | 10,39645 |
| 5dG5U | 202 | 9,27444 |
| 6C3xg | 201 | 8,80246 |
| 6D0sA | 197 | 9,39564 |
| 6DjJA | 170 | 9,42478 |
| 6Dqfa | 157 | 9,73984 |
| 6OfzB | 197 | 9,52026 |
| 6RpOU | 194 | 9,48390 |
| 6Rpl4 | 195 | 9,24407 |
| 6SZRE | 201 | 9,18412 |
| 6SqA9 | 191 | 9,62882 |
| 6Sqzw | 196 | 9,39557 |
| 6SsVO | 197 | 9,10037 |
| 6Ssdu | 197 | 9,42368 |
| 6SvTy | 197 | 9,39719 |
| 6wXyv | 214 | 9,06994 |
| 6x06f | 193 | 9,25065 |
| 71Uf5 | 192 | 9,58227 |
| 7GsLM | 153 | 9,95110 |
| 7Yasw | 197 | 9,55430 |
| 7ereS | 210 | 7,89675 |
| 7gYsH | 202 | 9,15317 |
| 7hBr9 | 197 | 9,24536 |
| 7k46S | 197 | 9,48344 |
| 7k4W5 | 208 | 9,24465 |
| 7lFQp | 240 | 9,69329 |
| 7mChB | 240 | 9,32253 |
| 7pFiQ | 194 | 8,75192 |
| 7qzoB | 198 | 7,95264 |
| 7rHEb | 198 | 9,36972 |
| 7revx | 197 | 9,27315 |
| 7sCqn | 207 | 9,48306 |
| 7sROW | 237 | 9,69232 |
| 7tI8r | 197 | 9,36972 |
| 7tK4s | 203 | 9,83596 |
| 7vOfA | 191 | 9,69355 |
| 7wTc4 | 203 | 9,81352 |
| 8Cmbt | 197 | 7,98739 |
| 8fjg9 | 223 | 10,25307 |
| 8fl1L | 150 | 11,18328 |
| 8mBy6 | 195 | 9,07059 |
| 8tAJs | 206 | 10,17532 |
| 98oX | 208 | 10,17725 |
| Ipr3 | 198 | 9,59601 |
| OVLd | 212 | 9,73519 |
| Qdn6 | 189 | 9,43110 |
| YpqP | 150 | 5,13042 |
| e73Z | 189 | 10,10447 |
| gOKo | 196 | 9,52064 |
| hyMf | 157 | 9,62476 |
| iEVB | 156 | 9,73397 |
| lzep | 209 | 10,04168 |
| pbi3 | 237 | 9,29732 |
| szwF | 200 | 8,86829 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_18821
1lm7s
|
3 | 33,8% | 130 | 1.212E-31 |
| 2 |
phalp2_26026
6VCZH
|
19 | 29,1% | 137 | 6.510E-22 |
| 3 |
phalp2_1723
2pp6N
|
16 | 29,2% | 140 | 9.154E-19 |
| 4 |
phalp2_20892
6T4HE
|
1 | 29,0% | 117 | 9.316E-16 |
| 5 |
phalp2_28559
83bNq
|
3 | 23,5% | 123 | 2.668E-13 |
Domains
Domains
1
131 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1oDTV)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50