Protein
- Protein accession
- 71CFO [EnVhog]
- Representative
- jfKR
- Source
- EnVhog (cluster: phalp2_26211)
- Protein name
- 71CFO
- Lysin probability
- 81%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKLAIDAGHGMGNRKAGVYDPGAVAAGETEAGIVMDWAETLKFYCLQAGINVFMIRTGATDANPVGGRDEQAERANCSHYLSLHCNAAGAVAATGTETLYRDRTDMLWAAKVQKAALGALRLADRGLKPESSGQHSRLAVFDFDGPCALCELGFITNPMDRQVLLARSNRIEFAIAVVEALKGGQK
- Physico‐chemical
properties -
protein length: 186 AA molecular weight: 19799,4 Da isoelectric point: 6,42 hydropathy: -0,08
Representative Protein Details
- Accession
- jfKR
- Protein name
- jfKR
- Sequence length
- 181 AA
- Molecular weight
- 19650,33290 Da
- Isoelectric point
- 7,89623
- Sequence
-
VRLCIDPGHGLHSSSPRHFDPGAVASSGEREADIVLAFARTLRTVCVANGIEVFMTRVTNDQPAPLVGRVQRATEAGADVLLSLHCNAAVDPRAHGTETLYRESREFAIEMQRATLAALGLRDRGVKRRPELAMLRFPKPCALIELGFISNAEDRAVLLDARSAPRFAAAIVVALAKEDWT
Other Proteins in cluster: phalp2_26211
| Total (incl. this protein): 112 | Avg length: 188,8 | Avg pI: 7,45 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| jfKR | 181 | 7,89623 |
| 11lXk | 182 | 7,19919 |
| 13xtx | 181 | 7,21249 |
| 14XoP | 181 | 4,66957 |
| 15fMK | 193 | 8,16874 |
| 15xxL | 180 | 9,02114 |
| 16svn | 221 | 7,74451 |
| 17Wtj | 181 | 8,64020 |
| 1GzPu | 186 | 5,17686 |
| 1Pjt7 | 195 | 8,54640 |
| 1XilQ | 182 | 9,14969 |
| 1XxRB | 188 | 6,03803 |
| 1gwk8 | 188 | 7,11842 |
| 1jWQT | 185 | 6,88754 |
| 1nhBY | 187 | 8,97427 |
| 1p779 | 201 | 5,06495 |
| 1q7fE | 166 | 4,93967 |
| 1rWYg | 188 | 7,04487 |
| 1sIeB | 210 | 6,43647 |
| 27ID2 | 193 | 8,88337 |
| 29pM4 | 188 | 6,64660 |
| 2FKRs | 177 | 10,67779 |
| 2GDm1 | 197 | 8,53847 |
| 2PgtY | 228 | 9,11636 |
| 2YBbB | 188 | 7,67141 |
| 2ZzSZ | 185 | 8,19911 |
| 2aaf4 | 180 | 4,89153 |
| 2sa1I | 237 | 4,98077 |
| 2tEtW | 210 | 6,35712 |
| 36BtI | 175 | 7,66612 |
| 38jXM | 185 | 8,16345 |
| 38yqf | 245 | 4,91466 |
| 39YFY | 176 | 4,81866 |
| 3NAIN | 181 | 5,79192 |
| 3Wxhw | 194 | 5,48175 |
| 3c0oN | 180 | 9,03707 |
| 3dlER | 210 | 9,57770 |
| 3hqQ0 | 184 | 5,11815 |
| 3nieS | 180 | 9,80895 |
| 3npoN | 185 | 8,89046 |
| 40pPA | 226 | 5,87757 |
| 41VLN | 191 | 8,28962 |
| 41YsL | 188 | 7,73013 |
| 440ye | 191 | 5,17305 |
| 4HeMO | 187 | 9,18399 |
| 4J4EN | 180 | 8,42971 |
| 4KOr8 | 163 | 5,27150 |
| 4Muj8 | 186 | 8,54549 |
| 4NHAW | 183 | 6,51167 |
| 4NJ4G | 176 | 9,72365 |
| 4NR7B | 182 | 6,20798 |
| 4OKoN | 188 | 7,71637 |
| 4a2q1 | 201 | 8,63240 |
| 4a5lw | 191 | 8,78454 |
| 4cbWx | 203 | 5,24728 |
| 4fQro | 180 | 9,01424 |
| 4fxV8 | 184 | 6,57197 |
| 4gy8c | 178 | 6,94427 |
| 4ljOa | 188 | 5,05295 |
| 4nsSm | 187 | 8,92682 |
| 4oQor | 188 | 8,33617 |
| 4xwH6 | 181 | 5,87149 |
| 4yGfF | 236 | 4,90466 |
| 52GZR | 188 | 7,66738 |
| 57z7c | 187 | 8,90542 |
| 58rQH | 183 | 6,51167 |
| 5EYCI | 195 | 8,59778 |
| 5HqIm | 180 | 8,73813 |
| 5Jz1E | 193 | 6,37804 |
| 5aRuh | 187 | 5,05295 |
| 5cQ0D | 182 | 8,52918 |
| 5hwpI | 187 | 8,92663 |
| 5iOI7 | 184 | 6,95638 |
| 5ibHH | 187 | 8,94945 |
| 5kove | 182 | 9,18089 |
| 5mlu4 | 191 | 7,66181 |
| 6PJ8Q | 181 | 6,92006 |
| 6PPLZ | 180 | 9,12345 |
| 6PTTI | 180 | 7,84459 |
| 6PTyU | 180 | 8,71621 |
| 6PWIX | 182 | 7,87038 |
| 6RdTa | 185 | 6,15057 |
| 6Rfgn | 180 | 9,02114 |
| 6RiIL | 180 | 8,35086 |
| 6SOTC | 185 | 8,19917 |
| 6STfR | 205 | 8,10086 |
| 6WjIJ | 243 | 6,50155 |
| 6XorP | 195 | 5,05807 |
| 71CL0 | 190 | 8,77391 |
| 7E08C | 142 | 8,53254 |
| 7ELdj | 193 | 6,29949 |
| 7H5Pa | 193 | 5,41803 |
| 7HQez | 186 | 9,05325 |
| 7UPBx | 225 | 6,23344 |
| 7YiWZ | 182 | 7,75025 |
| 82zFW | 216 | 8,51855 |
| 88pyB | 182 | 5,95902 |
| 89GPV | 180 | 9,01012 |
| 8flQX | 180 | 9,29745 |
| 8iF0l | 172 | 5,75975 |
| 8mTrt | 183 | 6,21486 |
| 8rfoi | 179 | 9,26187 |
| 99VM | 182 | 7,99532 |
| BURC | 174 | 7,62764 |
| CimV | 183 | 5,75793 |
| G7t3 | 174 | 8,58766 |
| H4Sd | 188 | 7,66760 |
| LhwP | 195 | 8,23289 |
| acXR | 161 | 8,59475 |
| kyOv | 191 | 9,54965 |
| uJt7 | 193 | 5,70683 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13042
82J9r
|
2 | 38,4% | 190 | 8.485E-52 |
| 2 |
phalp2_27233
3PKbz
|
18 | 34,6% | 179 | 4.186E-48 |
| 3 |
phalp2_24413
4m1OU
|
1246 | 39,2% | 181 | 1.475E-47 |
| 4 |
phalp2_33525
85Tz
|
32 | 35,7% | 179 | 2.310E-42 |
| 5 |
phalp2_18497
6MPko
|
7 | 34,5% | 185 | 5.432E-38 |
| 6 |
phalp2_13925
foQI
|
206 | 26,8% | 186 | 1.025E-34 |
| 7 |
phalp2_26616
7oxe5
|
7 | 31,1% | 183 | 4.442E-33 |
| 8 |
phalp2_26297
13Hnr
|
75 | 40,4% | 121 | 5.474E-32 |
| 9 |
phalp2_35303
72wI1
|
17 | 31,0% | 187 | 2.124E-29 |
| 10 |
phalp2_3633
4SuvT
|
23 | 35,7% | 126 | 1.019E-28 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(jfKR)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50