Protein
- Protein accession
- 6zW9I [EnVhog]
- Representative
- 2PRXw
- Source
- EnVhog (cluster: phalp2_20354)
- Protein name
- 6zW9I
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
MKTTILIITAFLFSSATFPALKKQPAKNHIEQYINKYLRTAKKEAELFNIPVSITLAQGIIESNCGRSSLARKHNNHFGVKWHKGRKEKFAVYQDDTPKDRFVVYRSSWWSYRDHSRLLTSRHYRHLTKLKRTDYKRWARGLKKCGYATHPKYAEILISVIEKYELWRYDLK
- Physico‐chemical
properties -
protein length: 172 AA molecular weight: 20495,5 Da isoelectric point: 10,11 hydropathy: -0,68
Representative Protein Details
- Accession
- 2PRXw
- Protein name
- 2PRXw
- Sequence length
- 190 AA
- Molecular weight
- 21201,15890 Da
- Isoelectric point
- 9,70928
- Sequence
-
MKNTINVLILLLLVTGLYGRKSIGAPAYHKMPAHFKAYVEEHITVATTEHSLFGVPASITLAQGLLESAAGTSDHVRLANNHFGIKAKDGNPLFVQLAIGKVKFSEGDFAKYASTWWCFRHHSKLLTSGSYAHILSLSGNNYKGWAYRLKRVGYAEDPHYVRKLIKLIENFELWRADGHSKPVANPNTRL
Other Proteins in cluster: phalp2_20354
| Total (incl. this protein): 122 | Avg length: 179,5 | Avg pI: 9,83 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 2PRXw | 190 | 9,70928 |
| 15ixo | 170 | 10,02382 |
| 18aSb | 194 | 8,75663 |
| 1IqO0 | 174 | 10,02491 |
| 1Izbw | 182 | 10,11781 |
| 1JH1L | 203 | 9,78342 |
| 1JIzF | 182 | 10,14760 |
| 1JL1L | 173 | 10,05083 |
| 1JWSr | 179 | 10,16610 |
| 1LLUa | 180 | 9,99868 |
| 1LZJC | 146 | 8,63066 |
| 1MF7I | 160 | 9,49814 |
| 1OLaJ | 165 | 9,11101 |
| 1aMBa | 152 | 10,93082 |
| 1gT5l | 129 | 9,97018 |
| 1yULV | 235 | 9,84634 |
| 27BQ9 | 173 | 10,10073 |
| 27h7g | 173 | 10,12929 |
| 2XoRa | 194 | 9,32305 |
| 30FZ0 | 174 | 9,99971 |
| 35T59 | 183 | 9,57228 |
| 362HK | 174 | 9,97908 |
| 3HEk | 235 | 9,15298 |
| 3ULbb | 192 | 9,73539 |
| 3Uqlr | 202 | 9,80056 |
| 3Usj5 | 174 | 10,02491 |
| 3Utzh | 172 | 10,00183 |
| 3W4Vw | 176 | 9,86162 |
| 3aWln | 248 | 8,12013 |
| 43TS8 | 174 | 9,95522 |
| 43sU6 | 208 | 9,35219 |
| 44ol2 | 174 | 9,89295 |
| 49Ama | 177 | 9,77826 |
| 49rtl | 183 | 9,75086 |
| 4Aax0 | 175 | 9,99880 |
| 4Cuxr | 174 | 10,00016 |
| 4DEux | 172 | 10,08287 |
| 4G5oD | 172 | 10,08635 |
| 4G8tN | 182 | 10,07165 |
| 4G9fR | 171 | 8,93991 |
| 4GAeF | 174 | 10,07159 |
| 4GAyA | 174 | 10,04806 |
| 4GDwH | 182 | 10,07165 |
| 4GzUr | 181 | 10,12490 |
| 4MVST | 173 | 10,05083 |
| 4NAco | 182 | 10,05431 |
| 4NAcq | 171 | 8,56129 |
| 4NKiw | 174 | 10,04651 |
| 4NOEo | 171 | 10,15894 |
| 4NnfI | 173 | 10,07771 |
| 4Nwj7 | 173 | 10,10627 |
| 4WqfC | 179 | 8,88821 |
| 4YsAF | 174 | 9,93169 |
| 4berD | 179 | 10,11652 |
| 4h4j4 | 179 | 10,32128 |
| 4heH8 | 174 | 10,07159 |
| 4nMXy | 180 | 9,99532 |
| 4nv6X | 172 | 10,00306 |
| 4oL3b | 174 | 10,07217 |
| 4oyYM | 174 | 9,95277 |
| 4qrkS | 180 | 10,04864 |
| 4wY7c | 211 | 9,30055 |
| 51fcp | 192 | 9,82899 |
| 53SyQ | 219 | 9,38655 |
| 53voZ | 174 | 10,04703 |
| 54EWS | 179 | 10,22896 |
| 56t0K | 182 | 9,89308 |
| 570au | 172 | 10,10131 |
| 588pf | 198 | 9,59336 |
| 58koG | 179 | 10,12355 |
| 5aenl | 174 | 10,02401 |
| 5bA9H | 206 | 10,00267 |
| 5bAqP | 171 | 8,75876 |
| 5c1n0 | 172 | 9,99810 |
| 5edtk | 200 | 9,80076 |
| 5fVtW | 173 | 10,02504 |
| 5fWTU | 194 | 9,75370 |
| 5gMV5 | 216 | 9,28205 |
| 5iIA0 | 173 | 10,05083 |
| 5lAnn | 189 | 10,00287 |
| 5lV63 | 172 | 10,07481 |
| 5mN4K | 159 | 9,85227 |
| 5ndah | 173 | 10,02504 |
| 5o17o | 173 | 9,88360 |
| 5o9T4 | 172 | 9,97740 |
| 5tro1 | 172 | 9,97908 |
| 5uHO4 | 142 | 9,97328 |
| 5wFeR | 172 | 10,13006 |
| 5xAEV | 172 | 10,13077 |
| 5xDi5 | 173 | 10,05031 |
| 5xfBc | 152 | 10,24843 |
| 5xlxH | 172 | 10,16088 |
| 5ysX8 | 173 | 10,07771 |
| 5ytAb | 173 | 10,07707 |
| 5zx90 | 174 | 9,97824 |
| 6GfOI | 173 | 10,02762 |
| 6NuSt | 184 | 9,68749 |
| 6VF3Y | 178 | 10,21651 |
| 6Y96z | 211 | 9,37475 |
| 7K8KB | 210 | 9,66763 |
| 7Y0LR | 174 | 10,10008 |
| 80NBF | 216 | 9,35670 |
| 80iT7 | 183 | 9,78999 |
| 8fLp9 | 152 | 8,71956 |
| 8m3JE | 173 | 10,07771 |
| 8nUvq | 181 | 10,12490 |
| 8oFW7 | 179 | 10,28169 |
| 8oGdp | 181 | 10,02350 |
| 8oScK | 174 | 9,97340 |
| 8oVWi | 203 | 9,72501 |
| 8pIXF | 143 | 8,99329 |
| F9Bk | 177 | 9,89295 |
| FiMv | 177 | 9,13564 |
| G1aA | 174 | 10,00016 |
| JuPl | 210 | 9,38668 |
| MvhI | 174 | 10,02350 |
| PFia | 173 | 10,04754 |
| jNpV | 170 | 9,99861 |
| lCID | 138 | 8,93914 |
| x9Gd | 173 | 9,97753 |
| xcw0 | 204 | 9,81649 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_564
Jnmz
|
8 | 42,5% | 141 | 3.230E-64 |
| 2 |
phalp2_4067
1ieds
|
18 | 37,1% | 159 | 8.313E-64 |
| 3 |
phalp2_9653
1OZ1H
|
16 | 39,5% | 134 | 1.843E-55 |
| 4 |
phalp2_37785
4zVlF
|
3 | 35,2% | 176 | 3.461E-55 |
| 5 |
phalp2_17942
11k4b
|
1 | 37,2% | 161 | 4.516E-45 |
| 6 |
phalp2_39528
5wRWK
|
1 | 35,6% | 129 | 5.095E-34 |
| 7 |
phalp2_28108
7xE0g
|
17 | 31,1% | 151 | 1.605E-32 |
| 8 |
phalp2_28258
Ddao
|
2 | 30,4% | 148 | 3.005E-32 |
| 9 |
phalp2_31185
7Uzlm
|
1 | 30,5% | 154 | 7.697E-32 |
| 10 |
phalp2_29619
83Xjg
|
46 | 32,1% | 146 | 1.053E-31 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(2PRXw)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50