Protein
- Protein accession
- 17u1X [EnVhog]
- Representative
- 2Ra8H
- Source
- EnVhog (cluster: phalp2_4434)
- Protein name
- 17u1X
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MTQIPLITLLLALTHVESNDRDNAIGDNGTSYGCLQIRAIYVKDVNRILGKEHYTHEDAFDRAKAYHMFIIYTDHYATRKRLGREPTQEDRVRIHNGGPNGWKKPHTKAYWNKVKNII
- Physico‐chemical
properties -
protein length: 118 AA molecular weight: 13718,4 Da isoelectric point: 9,41 hydropathy: -0,71
Representative Protein Details
- Accession
- 2Ra8H
- Protein name
- 2Ra8H
- Sequence length
- 85 AA
- Molecular weight
- 10050,16290 Da
- Isoelectric point
- 9,44322
- Sequence
-
YQIWRVYWQDATDWCKTLKGSYEDVRSSEYAERVVVAYWHRYARAAIRDNDLETLARVHNGGPKGHQKSATDPYWNKVSKLMKGK
Other Proteins in cluster: phalp2_4434
| Total (incl. this protein): 117 | Avg length: 125,7 | Avg pI: 8,23 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 2Ra8H | 85 | 9,44322 |
| 19gLk | 140 | 9,06608 |
| 1Ob0P | 151 | 9,72701 |
| 1PjeY | 129 | 10,50682 |
| 1QTKn | 62 | 9,61090 |
| 1VRjG | 128 | 5,76509 |
| 1XuF2 | 124 | 9,54604 |
| 1gH1l | 128 | 9,41865 |
| 1icA2 | 102 | 9,10024 |
| 1jYy | 118 | 5,35903 |
| 1pVzq | 111 | 9,27141 |
| 1q0uw | 150 | 9,75918 |
| 1siTp | 129 | 7,09234 |
| 1u3WX | 149 | 9,44747 |
| 1vzhZ | 146 | 9,13880 |
| 1w3yy | 118 | 9,18560 |
| 20wpi | 115 | 9,92473 |
| 26EHH | 146 | 9,18502 |
| 2BUu5 | 150 | 5,96738 |
| 2GGkt | 126 | 9,49814 |
| 2Ib7J | 123 | 6,04491 |
| 2YiV7 | 80 | 10,14624 |
| 2kRVb | 143 | 9,18586 |
| 2nC8v | 77 | 9,37385 |
| 2u5Ef | 126 | 5,61935 |
| 2xDzP | 152 | 8,92876 |
| 2ymsP | 108 | 5,02499 |
| 2z5zJ | 118 | 9,21113 |
| 2zrPd | 97 | 6,70236 |
| 2zxCD | 157 | 5,44349 |
| 358nb | 129 | 9,00315 |
| 3D5vr | 122 | 8,82542 |
| 3OR8T | 125 | 9,86787 |
| 3PhHv | 135 | 10,56239 |
| 3UYf5 | 127 | 9,86787 |
| 3XV9w | 82 | 10,21323 |
| 3ojKJ | 69 | 9,82313 |
| 44Wed | 140 | 5,10041 |
| 49hUS | 125 | 9,59962 |
| 4Bcs1 | 146 | 6,60113 |
| 4OOUS | 135 | 8,44653 |
| 4Upgd | 136 | 9,05898 |
| 4a12w | 149 | 9,44612 |
| 4ev3x | 134 | 9,84698 |
| 4fti3 | 105 | 9,85543 |
| 4krig | 138 | 7,98707 |
| 4mnqi | 130 | 9,76446 |
| 4ppQO | 129 | 9,84653 |
| 4rz0S | 114 | 10,06966 |
| 4uiIf | 116 | 5,46788 |
| 4ukgC | 116 | 5,46788 |
| 4wetf | 116 | 5,46788 |
| 4xBgu | 182 | 9,49228 |
| 4xnOc | 146 | 9,16136 |
| 50MQq | 118 | 9,67562 |
| 50fTE | 128 | 9,85233 |
| 593AG | 84 | 8,80382 |
| 5Hve6 | 89 | 10,07211 |
| 5bLwv | 114 | 10,07140 |
| 5eWGu | 127 | 10,21026 |
| 5lS0T | 115 | 10,07140 |
| 5ldiP | 122 | 9,75744 |
| 5mrF6 | 89 | 9,29797 |
| 5t3lR | 135 | 9,45244 |
| 6BdhT | 119 | 5,75486 |
| 6CmGK | 118 | 5,52119 |
| 6Jp2L | 120 | 9,32524 |
| 6ND9u | 121 | 7,85401 |
| 6P4Rs | 122 | 6,64336 |
| 7D0Mk | 108 | 6,07958 |
| 7DoI8 | 121 | 9,25181 |
| 7Dx1K | 151 | 9,89804 |
| 7EfrQ | 131 | 6,35826 |
| 7EqSx | 164 | 4,66616 |
| 7HbZm | 129 | 5,88149 |
| 7Su4R | 108 | 4,85771 |
| 7Sw5E | 135 | 8,56064 |
| 7VW7x | 116 | 7,16157 |
| 7VccH | 110 | 9,01437 |
| 80S72 | 135 | 9,34716 |
| 83j01 | 135 | 9,32247 |
| 849L0 | 168 | 9,81056 |
| 86R9h | 145 | 9,83770 |
| 87njG | 129 | 9,94491 |
| 8AOTR | 102 | 5,63436 |
| 8DI3F | 135 | 9,19385 |
| 8Ddsg | 112 | 5,44378 |
| 8EAvg | 135 | 8,34203 |
| 8ECoj | 109 | 9,40860 |
| 8EIjw | 135 | 8,25229 |
| 8ENfs | 152 | 9,89069 |
| 8ERkM | 128 | 4,88960 |
| 8EaRK | 136 | 5,25956 |
| 8EiJn | 135 | 8,56064 |
| 8Fg43 | 152 | 9,71373 |
| 8FjRP | 161 | 7,88663 |
| 8Fvkx | 151 | 9,89804 |
| 8G87e | 151 | 5,89269 |
| 8d0ml | 135 | 9,19385 |
| 8i06P | 139 | 4,84941 |
| 8t5xY | 137 | 8,82593 |
| 8uTUF | 110 | 8,68939 |
| 8w0PG | 116 | 5,46788 |
| 8wNZx | 121 | 5,39535 |
| 8yhAW | 136 | 5,27752 |
| ArO3 | 109 | 7,88160 |
| EqpF | 126 | 4,64059 |
| J0Vz | 81 | 9,57280 |
| QoUA | 120 | 6,82798 |
| Tevl | 101 | 10,12877 |
| TtBV | 145 | 6,50536 |
| VsN0 | 120 | 7,93898 |
| WkRI | 118 | 5,17794 |
| XOZk | 146 | 8,94584 |
| dalW | 134 | 10,44112 |
| s7rA | 157 | 6,10948 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_31842
4AvdF
|
3 | 52,6% | 57 | 2.232E-18 |
| 2 |
phalp2_16066
3XNWb
|
22 | 35,3% | 82 | 2.058E-17 |
| 3 |
phalp2_23582
1f8D
|
174 | 28,3% | 81 | 2.826E-17 |
| 4 |
phalp2_39140
2KtWA
|
11 | 33,8% | 59 | 3.303E-15 |
| 5 |
phalp2_27359
4BANv
|
5 | 31,7% | 85 | 1.176E-14 |
| 6 |
phalp2_11904
2rHNT
|
22 | 29,7% | 84 | 7.297E-13 |
| 7 |
phalp2_39040
8qRAE
|
1 | 32,2% | 93 | 5.755E-10 |
| 8 |
phalp2_32105
6iaas
|
89 | 31,3% | 86 | 1.086E-09 |
| 9 |
phalp2_10010
6Y9Um
|
3 | 24,6% | 65 | 3.872E-09 |
| 10 |
phalp2_6097
59Oiy
|
38 | 20,8% | 91 | 1.180E-06 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(2Ra8H)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50