Protein
- Protein accession
- 6wYLV [EnVhog]
- Representative
- 2awjQ
- Source
- EnVhog (cluster: phalp2_40043)
- Protein name
- 6wYLV
- Lysin probability
- 54%
- PhaLP type
-
VAL
Probability: 75% (predicted by ML model) - Protein sequence
-
VNVETYQAKVYEPASSPCWSLVADVYITELAMPVDEFKTVANSVRDAAQAFRLVLHKGEHGFVRVSEPVDYAVVLMGRSFSRGIHHCGVYYDGKVLHAQPDGTLHQALASLRDQYPLMEFWVR
- Physico‐chemical
properties -
protein length: 123 AA molecular weight: 13854,6 Da isoelectric point: 6,04 hydropathy: -0,06
Representative Protein Details
- Accession
- 2awjQ
- Protein name
- 2awjQ
- Sequence length
- 139 AA
- Molecular weight
- 15293,27190 Da
- Isoelectric point
- 6,90136
- Sequence
-
MPTDINAYLARSYGSAEQRPCWQLVADVYRRELAEPVTEYKSVGSSIRAIAGAFRLALTKSPHGFTEVAGQQQWAVMLLSKRPSLGWHHCGVIIDGRVLHAVEPGIGGVLYQDLATVLDAYRGVEYWARAERALEAPAP
Other Proteins in cluster: phalp2_40043
| Total (incl. this protein): 144 | Avg length: 123,7 | Avg pI: 6,36 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 2awjQ | 139 | 6,90136 |
| 13kmJ | 123 | 5,71643 |
| 18Zmq | 122 | 6,49200 |
| 1IJ25 | 124 | 7,04658 |
| 1IO0L | 130 | 7,00293 |
| 1J2Wq | 122 | 6,02388 |
| 1JIWq | 127 | 8,54968 |
| 1JJr3 | 122 | 6,02388 |
| 1JU1L | 122 | 5,90144 |
| 1KCKu | 123 | 6,01688 |
| 1KGfL | 123 | 5,42860 |
| 1KI5U | 122 | 6,01558 |
| 1KYkb | 122 | 6,02751 |
| 1KZH2 | 134 | 7,87573 |
| 1Kmtc | 122 | 5,90144 |
| 1Kunv | 123 | 5,61964 |
| 1Kv5T | 122 | 6,16643 |
| 1KzUT | 122 | 5,61287 |
| 1Lklp | 134 | 6,45068 |
| 1M5w7 | 122 | 6,94597 |
| 1MMRp | 126 | 8,45318 |
| 1Mnrn | 126 | 9,03062 |
| 1MrUm | 122 | 6,57055 |
| 1XIw3 | 122 | 5,66812 |
| 1XbDa | 122 | 6,17552 |
| 1XiYB | 122 | 5,89605 |
| 1XmFw | 122 | 6,16575 |
| 1a2Nx | 123 | 5,88360 |
| 1f1jM | 121 | 6,13528 |
| 1fPrp | 122 | 5,19863 |
| 1gx2M | 129 | 5,09922 |
| 1jZGY | 122 | 6,16575 |
| 1k4IX | 122 | 5,90383 |
| 1kTGB | 122 | 6,02587 |
| 1kTr5 | 122 | 6,39134 |
| 1oTaL | 122 | 5,68978 |
| 1oTle | 123 | 5,43275 |
| 1pfSy | 122 | 7,72450 |
| 1qk1M | 122 | 5,61287 |
| 1qoiz | 122 | 5,61287 |
| 1zHNN | 122 | 5,16907 |
| 21cPs | 122 | 6,16575 |
| 29lIn | 147 | 9,30132 |
| 2Knv6 | 122 | 6,16569 |
| 2Sf5C | 122 | 5,40041 |
| 2Unar | 127 | 6,26845 |
| 2VyfK | 122 | 6,02075 |
| 2cA1i | 128 | 5,84904 |
| 2cTTd | 123 | 5,86956 |
| 2cyNC | 128 | 7,83009 |
| 2rAiq | 127 | 6,99872 |
| 2xsVM | 128 | 9,15317 |
| 33R3X | 122 | 6,49087 |
| 35CC9 | 128 | 5,58963 |
| 35eXA | 88 | 9,30442 |
| 3MRN4 | 123 | 5,89104 |
| 3Mzc6 | 123 | 5,38847 |
| 3NebO | 122 | 5,50198 |
| 3OxEl | 123 | 6,03092 |
| 3P6xO | 122 | 6,03894 |
| 3bXdI | 128 | 5,56183 |
| 3c2SR | 122 | 6,04428 |
| 3dBJM | 122 | 5,41712 |
| 3g9bU | 122 | 5,67619 |
| 4CpiV | 123 | 8,80930 |
| 4JOCq | 128 | 9,20268 |
| 4KybF | 123 | 6,39395 |
| 4LTkT | 127 | 5,25439 |
| 4N0t8 | 123 | 5,02243 |
| 4Vpkz | 122 | 6,02075 |
| 4W4iU | 122 | 7,72558 |
| 4Xy52 | 121 | 5,73451 |
| 4e1zK | 123 | 6,16370 |
| 4ecqP | 124 | 6,54992 |
| 4efZD | 123 | 5,91281 |
| 4fUsu | 122 | 5,65653 |
| 4fxnK | 121 | 6,50456 |
| 4gFYE | 128 | 6,02069 |
| 4gKyW | 122 | 6,26874 |
| 4hHPD | 136 | 8,83212 |
| 4iZCf | 128 | 9,05673 |
| 4inly | 129 | 8,46613 |
| 4ivFH | 127 | 7,83189 |
| 4jBbQ | 115 | 5,22785 |
| 4vDVi | 123 | 5,63908 |
| 4xSZ3 | 130 | 6,20286 |
| 5BvGr | 141 | 6,16313 |
| 5DYVY | 127 | 5,63896 |
| 5IQUT | 126 | 5,90031 |
| 5IS79 | 123 | 6,38827 |
| 5IxUh | 126 | 6,17154 |
| 5Iye7 | 126 | 6,17154 |
| 5JQ8 | 122 | 5,88377 |
| 5n9Rj | 125 | 6,05184 |
| 5oMg7 | 121 | 5,90565 |
| 6AQKH | 123 | 6,56589 |
| 6BLsR | 103 | 9,17419 |
| 6CZH1 | 123 | 5,89843 |
| 6DUeJ | 123 | 6,02234 |
| 6De6x | 123 | 5,89110 |
| 6DjWA | 123 | 6,02746 |
| 6DyQw | 123 | 5,70001 |
| 6E2c3 | 123 | 5,70984 |
| 6E6vn | 123 | 6,02587 |
| 6F6lF | 123 | 6,02228 |
| 6FrZc | 123 | 5,38768 |
| 6J5YT | 123 | 5,43275 |
| 6Krug | 123 | 6,02234 |
| 6PvHj | 122 | 4,89761 |
| 6QvrF | 121 | 6,50002 |
| 6wZqd | 126 | 6,19922 |
| 6x3Sg | 124 | 6,95615 |
| 77qXG | 122 | 5,88360 |
| 7CjLC | 133 | 8,42346 |
| 7Isc8 | 127 | 8,90697 |
| 7LQGa | 127 | 6,09788 |
| 7UIYS | 122 | 6,94916 |
| 7ZBNM | 122 | 5,40052 |
| 7ZBWf | 122 | 5,42860 |
| 7dgCF | 121 | 5,66573 |
| 7jTp7 | 121 | 6,02098 |
| 7yXtv | 122 | 5,23978 |
| 7ylbF | 123 | 5,19084 |
| 7zKtN | 122 | 6,04906 |
| 83YJt | 122 | 5,41712 |
| 860oc | 122 | 6,94859 |
| 8JxlL | 121 | 6,18200 |
| 8dIx0 | 122 | 6,49087 |
| 8dYtY | 122 | 6,94808 |
| 8e5Z | 122 | 5,66829 |
| 8eiuZ | 122 | 6,16643 |
| 8euLT | 122 | 5,89605 |
| 8fneS | 122 | 5,67619 |
| 8iVSD | 122 | 5,43434 |
| 8kZ6k | 122 | 7,72944 |
| 8kvYQ | 125 | 5,61179 |
| 8n3LF | 132 | 9,29894 |
| EBIY | 122 | 7,72421 |
| OVO1 | 122 | 6,30097 |
| RAp6 | 122 | 5,62276 |
| XlYF | 128 | 6,81468 |
| bojO | 123 | 5,72558 |
| f6e1 | 126 | 5,32760 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_19713
4Ktlf
|
40 | 27,4% | 124 | 9.090E-19 |
| 2 |
phalp2_17762
7Akvb
|
83 | 25,6% | 125 | 1.388E-16 |
| 3 |
phalp2_2799
efC8
|
53 | 27,2% | 121 | 1.711E-15 |
| 4 |
phalp2_14093
8iNl2
|
704 | 25,7% | 132 | 1.888E-13 |
| 5 |
phalp2_30783
cA3P
|
33 | 22,5% | 133 | 4.831E-13 |
| 6 |
phalp2_19944
6EYn3
|
118 | 26,8% | 134 | 1.236E-12 |
| 7 |
phalp2_25010
PR2K
|
31 | 22,4% | 125 | 5.907E-12 |
| 8 |
phalp2_20666
7DUWI
|
54 | 26,1% | 134 | 1.104E-11 |
| 9 |
phalp2_23709
Dx61
|
3 | 21,0% | 138 | 2.819E-11 |
| 10 |
phalp2_10856
4iYRO
|
28 | 22,1% | 122 | 5.266E-11 |
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(2awjQ)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50