Protein
- Protein accession
- 6wFxH [EnVhog]
- Representative
- 8d7ux
- Source
- EnVhog (cluster: phalp2_14028)
- Protein name
- 6wFxH
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 95% (predicted by ML model) - Protein sequence
-
MIYNIPDKNVAYIAKARELYKNRDQYAYLYGAKGQKCTPEVFESLWAAEPNYFKKYNAQQKAQIKAFCLGKTVIDCSGFINLVTGKFMYSTAYINSCTNITTPDATKDGDLLYTTFGGRGRHIGLDIGHGFFMHCGKELETISIGVIDGFGWEKGGTYE
- Physico‐chemical
properties -
protein length: 159 AA molecular weight: 17822,1 Da isoelectric point: 8,20 hydropathy: -0,30
Representative Protein Details
- Accession
- 8d7ux
- Protein name
- 8d7ux
- Sequence length
- 184 AA
- Molecular weight
- 21013,40640 Da
- Isoelectric point
- 5,71354
- Sequence
-
MTGNEVSEKALKMYNERSNYAYLYGAKGEFGNEENITRIIKTWNSYFKKYSKEEIEKIKNFCLGKTLFDCSGFVCEILGAPDYNSATIIAKCNGTKVSDWGLDGKGTPGTLFWKSGHIGINRGDGTFLHMPTELHTIDVGKVSEYDWNVCGKWPNVEYSSNSSEIDYKKFYEEMSEIFNKYKEV
Other Proteins in cluster: phalp2_14028
| Total (incl. this protein): 178 | Avg length: 161,2 | Avg pI: 7,51 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8d7ux | 184 | 5,71354 |
| 1Hr7b | 179 | 5,26979 |
| 1k7XZ | 162 | 6,24163 |
| 21qyg | 164 | 8,60326 |
| 2335t | 180 | 5,68966 |
| 23Ak4 | 162 | 7,69494 |
| 23HpX | 180 | 5,50693 |
| 23MmJ | 162 | 8,57612 |
| 23aQ2 | 200 | 6,31665 |
| 23sjP | 162 | 8,57547 |
| 24rJn | 161 | 4,96013 |
| 24rwU | 167 | 6,89357 |
| 2lTrz | 158 | 8,71202 |
| 2lWJr | 158 | 8,70325 |
| 38P9s | 163 | 7,78831 |
| 3B691 | 158 | 8,51017 |
| 3KNyA | 158 | 8,50256 |
| 3TGQt | 168 | 9,09696 |
| 3TIIP | 160 | 7,03663 |
| 3TO1C | 160 | 8,95687 |
| 3WM7V | 160 | 8,71646 |
| 3dUo3 | 163 | 8,52383 |
| 3e3Gv | 172 | 8,23308 |
| 3fV5e | 175 | 6,88482 |
| 3gWrB | 162 | 6,06702 |
| 3ixzF | 185 | 9,27005 |
| 3lgso | 159 | 8,70338 |
| 3pwTw | 194 | 5,92117 |
| 3rWAh | 158 | 8,70325 |
| 3saJA | 158 | 8,71202 |
| 3tAIJ | 158 | 8,70325 |
| 3tsNJ | 162 | 6,04019 |
| 3xNgX | 158 | 9,04603 |
| 3yp7g | 158 | 8,50262 |
| 3yzz0 | 158 | 8,70370 |
| 41bv3 | 160 | 5,78288 |
| 41g1k | 152 | 8,23340 |
| 4yoMB | 159 | 5,65812 |
| 4ypgE | 161 | 5,90935 |
| 5KQu7 | 159 | 7,58092 |
| 5Kxbu | 158 | 8,71189 |
| 5LCTz | 159 | 7,58121 |
| 5LWKz | 158 | 8,86332 |
| 5MHfs | 162 | 5,94657 |
| 5MJJ0 | 162 | 6,14148 |
| 5MRq0 | 162 | 5,94657 |
| 5NAlH | 158 | 8,70325 |
| 5NFnt | 162 | 6,04013 |
| 5OF6z | 162 | 6,04019 |
| 5OF83 | 162 | 5,86677 |
| 5P9LM | 162 | 6,81041 |
| 5PeHf | 158 | 8,69480 |
| 5SMD8 | 162 | 5,86677 |
| 5T502 | 158 | 8,49508 |
| 5T504 | 161 | 8,18924 |
| 5ToRf | 158 | 8,70363 |
| 5TyOC | 158 | 8,72994 |
| 5Ugph | 162 | 5,95004 |
| 5V2eG | 159 | 8,25513 |
| 5V63C | 162 | 5,85393 |
| 5VTRt | 158 | 8,99548 |
| 5Vvx9 | 158 | 8,86345 |
| 5WGDO | 158 | 8,86332 |
| 5WVzJ | 161 | 8,18924 |
| 5XHZo | 161 | 8,69519 |
| 5XjPD | 158 | 8,71202 |
| 5Y7D4 | 158 | 8,86352 |
| 5YE13 | 159 | 8,19550 |
| 5YuI9 | 159 | 8,66167 |
| 5ZFzt | 158 | 8,70325 |
| 5ZlCz | 159 | 8,19556 |
| 603KS | 162 | 6,43175 |
| 604sr | 162 | 5,86166 |
| 608kB | 166 | 8,93675 |
| 608lq | 159 | 8,48773 |
| 60R7V | 162 | 6,04019 |
| 60s2V | 162 | 6,04019 |
| 60s46 | 162 | 6,03752 |
| 61naF | 162 | 5,75867 |
| 62Ak8 | 162 | 6,43454 |
| 62ufp | 158 | 8,69474 |
| 62y4Z | 158 | 8,50262 |
| 63Kch | 158 | 8,86326 |
| 63Z0H | 162 | 5,87041 |
| 64D8Z | 162 | 5,87041 |
| 64LNR | 162 | 6,03752 |
| 64LY9 | 158 | 8,50269 |
| 64QrH | 158 | 8,50256 |
| 64nBw | 158 | 8,84443 |
| 65J0Q | 162 | 6,04019 |
| 661eI | 159 | 8,86365 |
| 67GvV | 159 | 5,91941 |
| 67g2u | 162 | 6,04019 |
| 67g41 | 162 | 6,04019 |
| 68HFj | 162 | 5,86677 |
| 68iQx | 157 | 8,71202 |
| 68nh6 | 159 | 8,85378 |
| 68nhk | 159 | 8,18931 |
| 699Mc | 158 | 8,49514 |
| 69dAj | 162 | 5,69569 |
| 6aMQK | 162 | 6,04019 |
| 6aNUN | 159 | 8,50262 |
| 6aNV2 | 158 | 8,71208 |
| 6aoys | 162 | 6,04019 |
| 6bBBJ | 162 | 6,21798 |
| 6bTYW | 159 | 6,81553 |
| 6bchH | 159 | 8,87319 |
| 6bvCG | 161 | 5,73576 |
| 6cGBk | 158 | 8,50340 |
| 6cLvz | 158 | 8,48863 |
| 6cijJ | 161 | 8,44628 |
| 6cmaY | 162 | 5,86677 |
| 6d4So | 163 | 8,63137 |
| 6eEci | 159 | 8,56574 |
| 6fIPP | 162 | 5,87405 |
| 6g99p | 158 | 8,72117 |
| 6gZZI | 158 | 8,70325 |
| 6gjrK | 162 | 6,04019 |
| 6h3M5 | 162 | 5,76219 |
| 6jOKG | 158 | 9,09747 |
| 6jhh6 | 158 | 8,70318 |
| 6jlEM | 158 | 8,70325 |
| 6kQB4 | 158 | 8,87332 |
| 6kYNN | 162 | 5,52921 |
| 6lHyY | 159 | 8,85372 |
| 6lHyx | 158 | 8,50262 |
| 6m1es | 162 | 5,52921 |
| 6m5Qg | 158 | 8,20181 |
| 6m9Ih | 162 | 5,87041 |
| 6nABn | 158 | 7,58666 |
| 6p9FG | 162 | 6,43306 |
| 6q5HO | 158 | 8,86332 |
| 6qICB | 162 | 5,94657 |
| 6qNbN | 159 | 8,50262 |
| 6qNcW | 159 | 8,20201 |
| 6qiCV | 162 | 5,58116 |
| 6r77N | 158 | 8,71202 |
| 6rTMm | 158 | 8,66934 |
| 6sOyX | 162 | 6,14642 |
| 6t4Zv | 162 | 6,04013 |
| 6t8TY | 159 | 8,70338 |
| 6tQQI | 162 | 6,03485 |
| 6ttZ2 | 162 | 5,76702 |
| 6tx75 | 159 | 8,85378 |
| 6uoHh | 159 | 8,20175 |
| 6v1FH | 159 | 6,18371 |
| 6vABW | 162 | 6,15893 |
| 6vOtC | 158 | 8,51797 |
| 6wKu6 | 158 | 8,87325 |
| 6whcw | 159 | 8,85359 |
| 6wm7y | 159 | 8,18931 |
| 7WD8I | 158 | 8,71202 |
| 7WEwc | 158 | 8,45982 |
| 7XCyG | 162 | 6,03485 |
| 7XxAm | 162 | 5,94413 |
| 7YC7M | 162 | 5,60259 |
| 7YxAC | 159 | 8,54852 |
| 80qWF | 162 | 9,02282 |
| 81ySk | 162 | 6,03752 |
| 84gnQ | 162 | 5,43622 |
| 85gKU | 159 | 8,87319 |
| 86jNy | 162 | 7,61099 |
| 87RgY | 162 | 8,78248 |
| 88oFq | 162 | 5,94413 |
| 8dUVC | 162 | 5,95351 |
| 8mYWm | 162 | 6,04019 |
| 8mlmC | 162 | 5,94765 |
| 8nF9i | 122 | 8,94971 |
| 8qPCC | 162 | 5,59594 |
| 8r5ac | 158 | 9,01805 |
| 8rAOP | 162 | 6,04195 |
| 8rMN0 | 162 | 8,62634 |
| 8s18l | 174 | 8,37059 |
| CVL2 | 158 | 8,85378 |
| K11a | 158 | 8,86326 |
| NcZi | 159 | 8,48773 |
| q8wL | 159 | 8,81407 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_29720
1kB9N
|
9 | 33,3% | 132 | 1.742E-38 |
| 2 |
phalp2_7255
3TNPU
|
22 | 27,1% | 173 | 4.032E-31 |
| 3 |
phalp2_870
8brVc
|
9 | 33,8% | 121 | 3.936E-15 |
| 4 |
phalp2_11216
6pi59
|
34 | 26,2% | 145 | 2.514E-14 |
| 5 |
phalp2_23391
5URxG
|
99 | 21,4% | 149 | 5.498E-11 |
| 6 |
phalp2_37173
1LCVC
|
1 | 26,6% | 150 | 8.610E-10 |
| 7 |
phalp2_39783
o9Wk
|
1 | 23,3% | 163 | 1.333E-08 |
| 8 |
phalp2_4327
8rHwf
|
3 | 20,5% | 151 | 6.072E-08 |
| 9 |
phalp2_5115
1NAmt
|
1 | 24,0% | 150 | 1.505E-07 |
| 10 |
phalp2_32200
6Xp2c
|
36 | 22,0% | 159 | 7.535E-06 |
Domains
Domains
1
184 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8d7ux)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50