Protein

Protein accession
17O97 [EnVhog]
Representative
4rwBE
Source
EnVhog (cluster: phalp2_14388)
Protein name
17O97
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKTKLIVILAIFLSLNFGATIPNQVEAKESKPVARNFNKELFRRHAYHQFSKVVNYLTTRVHRTAYVFSGDQVSGWDCSGMVRWAYKQVGITLPHSANKQGHLGARVAIPKRGDIVVFAYPGRTDVNHAAIYLGQGLIIDANAGFGTTVIEPLSNFRTIKSGLLGCSNDPRSMFLRCRI
Physico‐chemical
properties
protein length:179 AA
molecular weight:19908,8 Da
isoelectric point:10,11
hydropathy:-0,04
Representative Protein Details
Accession
4rwBE
Protein name
4rwBE
Sequence length
179 AA
Molecular weight
19730,70480 Da
Isoelectric point
9,93092
Sequence
MKKYAMIAGIVLTLAGCAASTATAHTPEVVSVVTKEIKQVPVHKQLIKNAKAHRNTARMKQVIKYLETRVDKTAYVFSGASPRGWDCSGLVRWTYERFGIELPHSADAQGHLGKRVSIPKLGDIVVFAYNGSTDFYHAAIYIGNGKIINAHRGVHSTIIQPLTDYKSGQIRFVRVIPTL
Other Proteins in cluster: phalp2_14388
Total (incl. this protein): 317 Avg length: 181,3 Avg pI: 9,46

Protein ID Length (AA) pI
4rwBE 179 9,93092
12Bnx 167 10,20852
12MAf 180 9,75692
12U0Q 178 10,08197
1314W 180 10,04696
132p8 175 10,35196
133jP 182 9,79438
18Icu 185 10,00802
18hzV 193 9,82416
18rMP 185 9,85149
19JNj 175 9,93769
19NRA 175 10,04303
19PBD 185 10,12632
19QHy 178 10,01092
1HYVy 189 9,89914
1Jz5U 179 9,96941
1JzqC 185 10,21935
1LAQD 183 5,07660
1LycE 176 10,01047
1dUSo 191 9,23344
1dWjU 188 8,95474
1dYE2 207 8,41146
1e070 182 10,02885
1ewc3 181 10,05683
1ewx0 199 10,18628
1fFv6 188 9,31783
1kwxy 199 9,85072
1nLYC 166 9,86477
1nUvM 171 9,69722
1nsGm 181 9,67021
1oYXK 172 9,82487
1pF1Y 175 10,00725
24Q9L 175 10,08197
25MXF 203 10,09705
25NJ2 164 9,73261
25Ocb 166 9,96799
25gr3 178 9,90700
25hmH 169 10,30858
27OaF 191 10,21213
27SwD 166 10,04445
2Sr5L 159 9,56596
2Zs1M 169 9,96799
2ZzfB 143 10,15591
2a08i 151 9,43967
2bukO 174 9,66531
2cRBu 181 9,71888
2cUzD 206 6,57016
2cVdo 164 9,27373
2cVtX 167 9,87006
2hH3C 169 10,30864
2hNDm 186 9,97231
2hYDS 198 9,89385
2iAfr 173 9,90642
2iE7R 200 9,79966
2iKFs 166 9,80114
2irGn 182 9,82519
2irgJ 205 9,91267
2itsm 175 9,96728
2iw5y 178 10,13580
30DpE 169 9,96799
30UtK 191 10,29181
30gxr 179 9,97289
30lr7 191 10,59662
30yjR 179 10,11511
31CRf 179 10,00080
31HUo 169 10,15147
322nC 175 10,10789
32W2F 169 10,19846
36MAp 169 10,03774
36Ykx 195 9,97701
38aNG 190 8,49044
38dk3 185 10,09338
38frN 166 9,91815
38kfH 210 9,79528
38njg 167 10,12200
38pHr 176 10,19595
38qL8 182 10,01215
3Uja8 179 10,00022
3XGK3 186 9,86639
3Xxuy 178 9,72236
3b1L2 165 10,09370
3b4DZ 174 10,00867
3b4Vh 178 10,18950
3b4YJ 169 9,96799
3b5TF 175 10,17300
3b5o8 166 10,05083
3bdZP 169 9,92505
3bf96 175 10,35196
3eaxw 155 9,87735
3eyYO 158 10,19588
41RII 193 9,76736
424Lz 173 10,11266
44G2l 175 10,09409
44hkH 185 10,14296
465z1 169 9,96799
4660i 193 9,86690
46D5r 190 9,53740
46NK9 186 9,94117
46TBl 174 10,14083
46TUB 181 5,95482
46VFp 193 7,88676
46Y8i 180 9,97018
46qCn 178 9,75499
46vfi 175 10,35196
46vll 178 10,00867
46vnB 181 10,19066
46xNk 172 9,96670
470wp 191 9,69593
4740o 179 9,72643
475fA 191 10,57444
478mb 184 9,65293
47Bnh 191 10,31696
47GpA 181 9,83983
47HRS 167 10,17171
47gT9 178 10,00777
47gwV 192 10,55465
47pyL 174 9,93762
47vMX 191 10,24501
488Ob 185 9,85143
48QTN 181 9,62115
48a13 211 5,35283
48dxv 180 10,29226
48foY 169 10,11788
4963t 190 10,24501
498jm 185 9,97953
49AVi 186 10,16636
49Dvy 173 10,08655
49EKH 185 10,29278
49K2O 181 10,14689
49arK 189 9,91944
49jJI 173 10,13103
49jXV 197 10,03807
4AaIT 165 6,72300
4FOLb 192 9,56048
4IOLw 206 9,01895
4IZWN 182 9,85143
4IZj0 192 10,03826
4J76U 211 6,28710
4J9qn 185 10,22793
4Jmth 159 9,85723
4KSIx 194 7,83118
4KTql 190 7,76730
4Ko5g 194 6,30227
4NCnF 173 10,19601
4O9BI 159 9,81443
4ToMT 158 10,28150
4XR3K 160 10,03117
4YieV 159 9,96451
4Yv7T 159 9,99816
4a3Zb 173 10,21258
4a6E8 167 9,60510
4a6Wj 198 6,14381
4aDnW 199 9,92357
4aH6K 169 9,99777
4aJ9K 188 9,44257
4ac6Q 186 10,05889
4agYl 180 10,10705
4apaR 183 5,87166
4avFc 178 9,74435
4avPG 195 9,14776
4awVq 211 6,30415
4b8Xf 189 9,94169
4b9u9 175 10,20594
4bCZy 167 10,10221
4bErb 179 10,00725
4bJaG 169 10,15147
4bVzx 181 9,64462
4bWFp 178 10,10614
4bX4E 186 10,24133
4baAz 165 9,68226
4bsFt 196 5,96806
4bw22 197 10,09190
4c0kN 173 10,09493
4c0kV 174 10,10157
4l4HJ 186 9,03636
4l6rZ 174 10,08655
4ljpY 178 10,00789
4o8Mx 235 8,40972
4p35q 185 9,23369
4qclM 167 10,03549
4rkkt 178 9,49460
4rrhd 167 10,04780
4zTj1 204 5,69336
50JQP 182 10,22599
50Kf6 211 5,20187
50OUT 164 10,44699
534eD 144 5,90582
534md 177 9,71031
53ik8 194 10,15256
53nDH 194 7,74320
54AHj 176 9,81571
54CBi 210 9,74854
57ZHy 173 10,05044
5805I 180 5,05437
580JN 188 9,16581
5BMcQ 183 5,31714
5BUXX 174 10,01092
5CWQC 204 8,92470
5bIQl 176 7,72041
5bTvg 188 7,80636
5bXWN 167 10,13213
5cVQv 173 10,11266
5ceWp 197 5,48754
5d36Z 181 10,08822
5dlDT 175 9,89372
5dpE9 175 10,10705
5eSpM 164 10,25545
5fgu4 189 9,39486
5g9Tz 185 9,83886
5gMia 181 10,17023
5gNQ6 173 9,97089
5jUH1 188 9,39312
5kqr4 185 9,94626
5kssK 192 9,47023
5ktqA 197 8,77113
5lMcR 183 5,08512
5lV2t 181 9,99958
5lWud 185 9,97424
5m7J4 236 6,97223
5mh2v 181 9,86793
5mqeF 232 6,22361
5n3bt 185 8,85359
5uiUU 174 10,10157
5waqi 193 10,18725
5weTa 181 10,06701
5xBAg 194 8,75218
5yoy9 179 10,00802
5yp3s 180 5,16129
5yqNE 142 10,10221
6BNGd 211 9,93073
6BOce 178 9,56216
6BSAW 175 10,16752
6BTUQ 191 9,54334
6BVWW 197 9,09709
6CGIC 160 9,61786
6DTzW 159 9,70837
6DVFK 159 9,78412
6F29D 158 9,95877
6F5YF 160 9,76427
6GA8i 189 9,32144
6GVSF 182 10,04116
6GkrU 237 6,97161
6GkxE 189 9,16594
6GlpV 193 8,57031
6GlqN 192 9,11346
6GmTM 190 8,90645
6Golc 193 8,53324
6ICGX 188 10,00796
6IJMz 167 9,81210
6Is8t 231 6,11181
6Jfkm 159 9,64681
6KNwK 162 9,78548
6M5aW 194 6,52980
6M6V3 192 9,11346
6Mp0u 181 9,74022
6NveM 192 9,25478
6Qruj 185 9,87683
6RRGp 193 9,18444
6RYYf 159 9,74190
6S2t8 158 9,33949
6SJ47 159 9,96154
6xH7m 173 10,00235
6yhty 179 5,95902
7G7Vh 159 9,64687
7XFgO 193 9,86233
7XIwz 189 7,74655
7XbIR 169 10,07514
7Xe8j 191 9,70741
7Xe93 167 9,81520
83EWH 188 9,85356
83FIv 178 9,93021
83FsX 175 9,87735
83YxI 191 9,75279
87thU 177 9,69741
87wdm 176 9,78638
8825Q 176 9,96264
88eUN 176 9,96264
89pJ8 178 10,01092
8bMgF 188 9,85298
8jDan 191 9,53637
8kejk 181 10,14773
8mS9e 205 5,52938
8mTuc 169 10,04155
8mVc7 213 9,37333
8mxiN 173 9,91796
8mzhW 173 10,34564
8tjiU 187 10,03987
FQT7 183 5,07557
FyIo 173 10,29252
Gh5m 185 9,97289
GiHd 186 10,36144
H2ec 175 10,10614
Kcg2 179 10,21394
KsoP 191 8,77526
LcFp 183 5,08865
MJX1 188 9,78522
Qa1x 191 10,21697
S3li 185 9,94394
S5Ft 169 10,15688
SG6w 181 10,26654
T8fa 169 10,00164
Td72 175 9,83319
U1lp 179 10,11511
U1pj 178 10,08197
U3oN 185 9,81256
UjBb 174 10,15991
Ujxl 186 9,66396
UljR 179 10,26796
Wd8D 210 9,74854
auYo 188 9,91209
qx3O 195 5,38313
A0A6J5L392 189 9,74396
A0A6J5LRS5 181 10,20252
A0A6J5TBR2 183 9,92138
A0A6J7WKL4 166 9,76446
A0A6J7WRD6 176 9,69754
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_16083
4957B
139 39,3% 201 3.838E-61
2 phalp2_36394
GAUL
11 49,7% 187 1.230E-59
3 phalp2_36437
12FCO
2 38,8% 175 7.788E-52
4 phalp2_9513
12BPS
3 74,7% 115 1.229E-46
5 phalp2_14699
6wXZL
6 34,1% 120 7.735E-19
6 phalp2_22117
6hWBF
1 33,8% 118 1.737E-17
7 phalp2_14587
5e6hT
9 29,6% 135 3.235E-17
8 phalp2_25287
84yHP
1 27,0% 170 3.235E-17
9 phalp2_40507
4EDHv
24 31,3% 118 1.121E-16
10 phalp2_22894
2Sg1U
2 24,1% 153 7.216E-16

Domains

Domains
Disordered region
NLPC_P60
Representative sequence (used for alignment): 4rwBE (179 AA)
Member sequence: 17O97 (179 AA)
1 179 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00877

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4rwBE) rather than this protein.
PDB ID
4rwBE
Method AlphaFoldv2
Resolution 87.22
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50