Protein
- Protein accession
- 6rhjV [EnVhog]
- Representative
- 8tT3L
- Source
- EnVhog (cluster: phalp2_898)
- Protein name
- 6rhjV
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MTANELVAYATNLIGTPYVWGGNTPAQGLDCSGLLYYIQKKAGSEVEDMTASGYSMIGKKIDIVQKKPGDFLFFGRPVTHCAIYIGNGYMIESRGGRKNTASNPGIGVVKSLVSRRSDLSCVRRVWDSSSSYIVGQTYRTQVDHLHVRFSVWGKIKGYAQLTADGMKHAYSDGCLKKGTTVTVKDLKKDDAGATWVKIPSGWICAITAKGDIYLS
- Physico‐chemical
properties -
protein length: 215 AA molecular weight: 23407,6 Da isoelectric point: 9,35 hydropathy: -0,19
Representative Protein Details
- Accession
- 8tT3L
- Protein name
- 8tT3L
- Sequence length
- 191 AA
- Molecular weight
- 21493,11330 Da
- Isoelectric point
- 9,31525
- Sequence
-
MTGQNLIDAFKELLGKPYVWGGKSMTEGGYDCSGALYVSANHAGYKLPRWTAQAYSKLGKIIPVGFQKPGDCLFFGSSQYRITHCAVYLGNGLMIESRGSINNTKSNPGKGVVISNVGRRSDLRVVRRWWDETEVNAYEYKINYNYTVQVDHLHVRWSAGGNIKTINETHTGRNETCLCRWLSEKRNCSNL
Other Proteins in cluster: phalp2_898
| Total (incl. this protein): 122 | Avg length: 216,7 | Avg pI: 9,17 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8tT3L | 191 | 9,31525 |
| 3B5MG | 219 | 9,06891 |
| 3GPvu | 217 | 9,36160 |
| 3maIS | 221 | 9,13229 |
| 3mxqo | 219 | 9,27005 |
| 3pjW0 | 215 | 9,26619 |
| 3qbXb | 218 | 8,73071 |
| 3sH8U | 218 | 9,25084 |
| 3t3Xf | 215 | 9,10972 |
| 3tq2k | 218 | 9,02952 |
| 3wSyE | 218 | 8,15643 |
| 3xJZ2 | 218 | 9,08529 |
| 3xVF3 | 218 | 9,18354 |
| 5KFNN | 218 | 9,27225 |
| 5KLBJ | 218 | 8,96409 |
| 5L6wM | 218 | 9,24311 |
| 5LGM3 | 219 | 9,14847 |
| 5Mr8S | 216 | 8,93675 |
| 5O2GL | 216 | 9,38249 |
| 5Omn1 | 215 | 9,20281 |
| 5PBTN | 216 | 9,38249 |
| 5Pnj8 | 215 | 9,25136 |
| 5PsFZ | 216 | 9,17503 |
| 5Q9OL | 218 | 9,18354 |
| 5QWtf | 219 | 9,24098 |
| 5RXUA | 219 | 9,15511 |
| 5RZXA | 216 | 9,18354 |
| 5RzNs | 221 | 8,60339 |
| 5Sfjf | 218 | 8,88337 |
| 5Smdl | 218 | 8,88350 |
| 5T8H2 | 219 | 9,13757 |
| 5TXmo | 216 | 9,45927 |
| 5UWWA | 215 | 9,18354 |
| 5UjvO | 216 | 9,07285 |
| 5V64X | 215 | 9,28449 |
| 5V89B | 216 | 9,18373 |
| 5WRIW | 218 | 9,17168 |
| 5WuJy | 216 | 9,70528 |
| 5WwK2 | 216 | 9,22248 |
| 5WwK4 | 218 | 9,07413 |
| 5XBEA | 216 | 9,17161 |
| 5XH0T | 219 | 9,14853 |
| 5XSdi | 216 | 9,53070 |
| 5XZZZ | 216 | 9,29958 |
| 5ZGNI | 218 | 9,66370 |
| 5ZPNB | 215 | 9,12867 |
| 5Zggv | 218 | 8,99523 |
| 61nd6 | 216 | 9,76478 |
| 62IbT | 218 | 8,96383 |
| 62IbU | 219 | 9,36173 |
| 63GZo | 219 | 9,05292 |
| 63L8l | 218 | 9,09663 |
| 63Ter | 216 | 9,24659 |
| 63WHc | 216 | 9,61322 |
| 63kQh | 218 | 9,08548 |
| 63zW0 | 215 | 9,17509 |
| 64Wm8 | 218 | 9,14673 |
| 64n32 | 216 | 9,42774 |
| 65sCc | 216 | 8,86294 |
| 6678e | 215 | 9,06762 |
| 66TVE | 206 | 9,13370 |
| 68AMo | 215 | 9,00038 |
| 68Rk7 | 216 | 9,38229 |
| 68Z2P | 219 | 9,29971 |
| 69dCf | 216 | 9,27212 |
| 69sDV | 218 | 9,08529 |
| 6aKMk | 215 | 9,17509 |
| 6aMS3 | 218 | 9,20913 |
| 6afiW | 216 | 9,08529 |
| 6b4ds | 218 | 9,14685 |
| 6bJeY | 218 | 9,27212 |
| 6bN4Z | 215 | 8,87125 |
| 6dx3s | 218 | 9,42749 |
| 6dz0Y | 216 | 9,16059 |
| 6eB3B | 216 | 9,24659 |
| 6fT87 | 219 | 9,06337 |
| 6fUcI | 216 | 9,45953 |
| 6hQnc | 216 | 9,17161 |
| 6hSrV | 215 | 9,06807 |
| 6igIa | 218 | 9,25916 |
| 6k3kr | 218 | 9,33910 |
| 6kAkY | 216 | 9,43909 |
| 6ke5P | 217 | 8,98433 |
| 6mnfW | 217 | 9,10630 |
| 6nA2K | 218 | 9,48061 |
| 6ogXP | 216 | 9,08516 |
| 6ogZe | 218 | 8,97402 |
| 6ovoQ | 215 | 9,39796 |
| 6oxmS | 219 | 9,56319 |
| 6p8SA | 215 | 9,28243 |
| 6qk0X | 215 | 9,48809 |
| 6rFIU | 218 | 9,35296 |
| 6rNpT | 216 | 9,25465 |
| 6s21X | 218 | 8,21116 |
| 6t0Vv | 216 | 9,48170 |
| 6t5JR | 215 | 9,63991 |
| 6toQx | 218 | 9,06350 |
| 6trLv | 219 | 9,09689 |
| 6v0T3 | 218 | 9,23408 |
| 6v0T5 | 218 | 9,12100 |
| 6vPKF | 219 | 8,94423 |
| 6wm73 | 221 | 9,25284 |
| 70QxT | 216 | 9,36753 |
| 7WPMh | 215 | 8,83135 |
| 7XrxH | 218 | 8,96370 |
| 7Y6ia | 215 | 9,04164 |
| 86fPy | 215 | 9,16059 |
| 86stC | 219 | 9,26432 |
| 887Nc | 215 | 8,97421 |
| 8bXEe | 219 | 9,06305 |
| 8dVfb | 218 | 8,73071 |
| 8eWeK | 220 | 8,95416 |
| 8eokr | 215 | 9,04164 |
| 8f61J | 215 | 8,90465 |
| 8iKzA | 216 | 8,52835 |
| 8lz4C | 216 | 9,54901 |
| 8mYSE | 217 | 9,13983 |
| 8mgU3 | 215 | 9,36895 |
| 8oA9n | 219 | 9,38229 |
| 8pCtu | 215 | 9,04151 |
| qcBG | 216 | 9,24659 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_17188
3dXMY
|
4 | 43,0% | 144 | 4.302E-35 |
| 2 |
phalp2_7249
3QzVS
|
32 | 31,5% | 130 | 1.605E-16 |
| 3 |
phalp2_29063
6QfOM
|
447 | 32,0% | 128 | 1.396E-15 |
| 4 |
phalp2_22117
6hWBF
|
1 | 33,8% | 127 | 3.525E-15 |
| 5 |
phalp2_24590
56wtZ
|
13 | 31,1% | 135 | 1.647E-14 |
| 6 |
phalp2_30337
4DjMH
|
5 | 33,0% | 121 | 1.219E-12 |
| 7 |
phalp2_4609
4iAfK
|
3 | 28,5% | 126 | 1.625E-10 |
| 8 |
phalp2_27807
7Tiwg
|
23 | 29,2% | 123 | 1.142E-08 |
| 9 |
phalp2_5658
4vbZ6
|
13 | 25,3% | 146 | 5.749E-07 |
| 10 |
phalp2_6899
2tG8S
|
2 | 25,8% | 139 | 7.761E-07 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8tT3L)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50