Protein
- Protein accession
- 6nBex [EnVhog]
- Representative
- 7bfSL
- Source
- EnVhog (cluster: phalp2_3939)
- Protein name
- 6nBex
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MNITNDYLPIGKYHRPGTKIKPTKIAVHYVGNAGSSAKGNRNYFANCSNYVSSHYIIGLNGEILRLIPENEISYCTNQANSYTISIECCHPDRTGKFNDKTLETLIELCADICKRYGFNPLTDIVRHYDVTKKACPLWWAPNGPNKSANADFIAFKNSVKNKILEEEQIMKQNIKINGKIKTVDAINKDGYTYIKIRGLSDILNIGYDKETKLISVSVK
- Physico‐chemical
properties -
protein length: 219 AA molecular weight: 24688,0 Da isoelectric point: 9,11 hydropathy: -0,44
Representative Protein Details
- Accession
- 7bfSL
- Protein name
- 7bfSL
- Sequence length
- 207 AA
- Molecular weight
- 23620,97430 Da
- Isoelectric point
- 8,87370
- Sequence
-
MKITEMLLTPSLYNRQQTKINVTKIAVHYVGNPNSTALANRNYFESLSKSRTTKASSHYIIGLQGEIIRCIPEKEQSICTNSANPYSISIECCHPDTTGKFKETTYNALIELCADICRRYNLNPLADIIRHYDVTGKICPKWFVDNPKEWEVFRNKVNVAIEMTFEEALKIVAEKVDTSYKFWLGKRDIDPSFPALIIKIAKSYGGK
Other Proteins in cluster: phalp2_3939
| Total (incl. this protein): 153 | Avg length: 235,4 | Avg pI: 8,16 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7bfSL | 207 | 8,87370 |
| 136NT | 239 | 6,75608 |
| 13EGi | 241 | 8,90065 |
| 13IUx | 180 | 8,68720 |
| 13cIN | 239 | 6,79205 |
| 14yFs | 266 | 9,16362 |
| 16S5N | 249 | 8,95313 |
| 1AQPY | 248 | 8,94739 |
| 1E6m7 | 219 | 6,12869 |
| 1H2MW | 255 | 9,19463 |
| 1HKvr | 261 | 8,95255 |
| 1LESv | 198 | 6,19036 |
| 1LG56 | 197 | 8,14901 |
| 1a8XU | 273 | 5,02982 |
| 1cqaJ | 184 | 7,70318 |
| 1csGY | 186 | 8,17499 |
| 1cuux | 184 | 9,17071 |
| 1dn8d | 226 | 8,43551 |
| 1dugi | 267 | 4,89363 |
| 1fR3V | 222 | 7,23006 |
| 1g0ed | 251 | 8,24314 |
| 1g0fJ | 250 | 6,18570 |
| 1jVk1 | 184 | 8,78725 |
| 1kj1F | 262 | 9,20468 |
| 1kpWv | 184 | 8,78725 |
| 1laAF | 260 | 8,94197 |
| 1njFi | 247 | 9,13229 |
| 1njWo | 246 | 9,13216 |
| 1rc9J | 205 | 8,10434 |
| 23sUT | 193 | 7,76457 |
| 25m8v | 175 | 6,22884 |
| 2G5RL | 251 | 8,87622 |
| 2G5Wf | 279 | 8,70679 |
| 2Npas | 186 | 8,81336 |
| 2V4Mg | 243 | 5,10229 |
| 2VCbD | 246 | 8,36311 |
| 2VCi1 | 246 | 7,60730 |
| 2XyNC | 180 | 8,94030 |
| 2auD8 | 329 | 8,69345 |
| 2v9td | 189 | 6,24259 |
| 3PF2I | 275 | 9,52715 |
| 3aqpo | 200 | 6,46949 |
| 3aroR | 200 | 7,22517 |
| 3cuwG | 199 | 8,43519 |
| 3cwxQ | 198 | 8,77526 |
| 3fsM4 | 196 | 6,95234 |
| 3iUOa | 219 | 9,17413 |
| 3kPEg | 247 | 8,86751 |
| 3lcD5 | 219 | 9,17413 |
| 3ngFJ | 208 | 6,29108 |
| 3p2ML | 263 | 9,08174 |
| 3qpt4 | 263 | 9,12010 |
| 3sq3S | 219 | 9,24530 |
| 3tTy1 | 245 | 9,02385 |
| 3tiPE | 246 | 9,20739 |
| 3wXjm | 263 | 9,25000 |
| 3wdJM | 246 | 9,21751 |
| 3xQpg | 326 | 9,13802 |
| 3xRpJ | 330 | 9,23904 |
| 41qSe | 242 | 9,76627 |
| 4LqOS | 248 | 5,00538 |
| 4OHuC | 232 | 8,72233 |
| 4PzvM | 224 | 5,87342 |
| 4SFP1 | 330 | 9,31583 |
| 4SFY0 | 326 | 9,11443 |
| 4USy4 | 199 | 6,69884 |
| 4ZHeI | 248 | 8,85385 |
| 4ZO4m | 248 | 6,42067 |
| 4g6yQ | 187 | 5,68529 |
| 4hTuV | 243 | 5,69000 |
| 4hU05 | 250 | 5,50118 |
| 4hwaP | 225 | 7,65680 |
| 4iwtR | 233 | 8,99806 |
| 4kQ7Q | 253 | 8,79299 |
| 4tJ6A | 251 | 7,99326 |
| 4xvW4 | 220 | 7,01390 |
| 4xwAO | 260 | 6,09731 |
| 4xwFQ | 220 | 6,25652 |
| 4xwGT | 220 | 7,64106 |
| 4xwGv | 249 | 9,15188 |
| 4xwUC | 220 | 6,08543 |
| 4xwvD | 246 | 6,46529 |
| 4yAa2 | 250 | 8,59533 |
| 4yBEJ | 248 | 8,11439 |
| 4ybZw | 289 | 9,23962 |
| 5EJ6u | 204 | 6,23623 |
| 5HH6E | 329 | 8,70080 |
| 5HLsc | 266 | 8,89575 |
| 5KmpI | 261 | 9,41337 |
| 5NviF | 284 | 8,82993 |
| 5QZpL | 246 | 9,14157 |
| 5RKS6 | 262 | 9,53728 |
| 5RyQX | 219 | 9,17413 |
| 5WkIz | 258 | 9,56848 |
| 5hUHr | 244 | 6,18433 |
| 5i4A4 | 244 | 6,66508 |
| 5indZ | 244 | 6,25504 |
| 5jzlE | 306 | 8,93288 |
| 5uk15 | 180 | 7,69665 |
| 66Jk9 | 219 | 9,08838 |
| 67b5 | 223 | 8,74992 |
| 6DZV | 210 | 9,25826 |
| 6Ppnf | 213 | 5,64271 |
| 6Xpdk | 174 | 8,61937 |
| 6Xqbi | 280 | 8,95403 |
| 6Xqi0 | 176 | 9,32015 |
| 6diLt | 202 | 8,77629 |
| 6g0EV | 263 | 9,30977 |
| 6hiiI | 202 | 8,35518 |
| 6iYNd | 261 | 9,47094 |
| 6pBE3 | 261 | 9,45843 |
| 6tWRj | 262 | 9,25000 |
| 6tky7 | 262 | 9,18702 |
| 72X26 | 184 | 8,93824 |
| 75OmR | 261 | 9,06685 |
| 79pfr | 202 | 8,69371 |
| 7E9oU | 188 | 6,69043 |
| 7KxHW | 262 | 9,25007 |
| 7YRSK | 187 | 5,51500 |
| 7cUTG | 261 | 8,72710 |
| 7oqYy | 256 | 8,47890 |
| 7oqZr | 256 | 8,45575 |
| 7or0S | 255 | 8,97685 |
| 7or0b | 255 | 7,96476 |
| 7or2P | 255 | 8,62892 |
| 7qcA9 | 261 | 8,98614 |
| 7r5c1 | 180 | 8,66599 |
| 7rg9E | 253 | 8,97015 |
| 7srcC | 258 | 8,44705 |
| 7wCWu | 248 | 9,10843 |
| 7wCXY | 261 | 8,83728 |
| 7whLR | 252 | 6,66013 |
| 80rMq | 202 | 8,54549 |
| 84MVB | 245 | 9,23363 |
| 87QO0 | 223 | 5,21176 |
| 8fx6Z | 197 | 5,98977 |
| 8gi9f | 262 | 9,25007 |
| 8nEah | 200 | 8,58495 |
| 8ouIl | 261 | 9,41350 |
| 8sEBW | 245 | 9,18218 |
| 8vrLM | 210 | 8,06153 |
| 91u7 | 198 | 8,53557 |
| DNOx | 247 | 8,97176 |
| HKcV | 184 | 8,78725 |
| ZjXy | 255 | 9,13345 |
| dlpm | 180 | 8,73980 |
| f7fr | 199 | 6,37759 |
| mY7M | 217 | 8,70054 |
| n3B3 | 303 | 9,08129 |
| qaO3 | 253 | 8,96660 |
| umVf | 167 | 7,06460 |
| xpQQ | 184 | 6,94285 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_25288
86peP
|
187 | 49,0% | 163 | 1.981E-74 |
| 2 |
phalp2_27786
7skBJ
|
83 | 48,4% | 188 | 1.981E-74 |
| 3 |
phalp2_7626
5U1PP
|
11 | 51,8% | 158 | 1.878E-67 |
| 4 |
phalp2_11225
6wIAx
|
104 | 50,5% | 170 | 3.596E-64 |
| 5 |
phalp2_31879
4GdWf
|
8 | 45,2% | 157 | 1.469E-55 |
| 6 |
phalp2_26646
2dQ36
|
4 | 32,6% | 184 | 4.227E-53 |
| 7 |
phalp2_10049
7q2PM
|
57 | 42,4% | 198 | 7.164E-52 |
| 8 |
phalp2_37528
3iFdV
|
13 | 30,9% | 181 | 8.066E-44 |
| 9 |
phalp2_23523
75EkF
|
74 | 34,7% | 164 | 3.138E-41 |
| 10 |
phalp2_5052
1q1Q3
|
64 | 30,9% | 184 | 2.535E-39 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7bfSL)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50