Protein
- Protein accession
- 6mpC8 [EnVhog]
- Representative
- 5QSR9
- Source
- EnVhog (cluster: phalp2_215)
- Protein name
- 6mpC8
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MISPYKGTFRVSQAFDHLRANGTLHQGFDLVGISSKQLHSTVYGQVIRAGWENSKNHKQGFGLRVVLRIAHTNYFMYYGHLSKINVTVGQKVKPGTLIGTEGSTGHSTGSHLHWEIRECDVRTGYQKMPEYSGIPNVAGKTAYTSSSERRMSAHLPCLRMDQHPAGAPSVPGLRHWHG
- Physico‐chemical
properties -
protein length: 178 AA molecular weight: 19753,2 Da isoelectric point: 9,86 hydropathy: -0,50
Representative Protein Details
- Accession
- 5QSR9
- Protein name
- 5QSR9
- Sequence length
- 241 AA
- Molecular weight
- 25945,22760 Da
- Isoelectric point
- 9,39467
- Sequence
-
VLREAVLMVSAAFLFGIEVDFLISPYKGTFRVSQAYRNLRANGTYHQGYDLVGIGDKSIYCPVYGTVIRAGWECATLPKKGFGQRVVVRIGSTAYYMYFGHLSKINVAVGQKLKPGDLIGAEGSTGHSTGSHLHWEIRINDISTGYVSVHQYAGIPNVAGSTAYTSNWVAELFGPSNLKKSTSGFPQRLYNSVLQGALGIDKDGIFGANTEKTVKEFQSAHGLTSDGIAGAKTKVALAKQL
Other Proteins in cluster: phalp2_215
| Total (incl. this protein): 117 | Avg length: 206,1 | Avg pI: 8,36 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5QSR9 | 241 | 9,39467 |
| 13Bqq | 170 | 6,74090 |
| 13yF1 | 241 | 9,53644 |
| 1GbtJ | 173 | 6,10931 |
| 1NATe | 168 | 5,19897 |
| 1NzaU | 274 | 9,12577 |
| 1gFI9 | 195 | 6,69424 |
| 1gyD9 | 170 | 6,36571 |
| 23Lll | 160 | 6,30654 |
| 24qtF | 168 | 6,27823 |
| 2LlV4 | 133 | 6,00222 |
| 2m1IB | 222 | 9,39506 |
| 2oEIq | 190 | 9,83286 |
| 2ujS | 169 | 7,05215 |
| 39Xb9 | 166 | 8,43345 |
| 39XbA | 169 | 8,74419 |
| 3Askc | 222 | 9,38636 |
| 3KNX5 | 225 | 9,98630 |
| 3VFa4 | 184 | 5,82704 |
| 3WMss | 178 | 5,79584 |
| 3dTmH | 171 | 6,20616 |
| 3de6K | 188 | 6,69685 |
| 3e3Yi | 191 | 4,86936 |
| 3fTlV | 170 | 6,11425 |
| 3gac2 | 169 | 5,85904 |
| 3ik8H | 173 | 5,51704 |
| 3iozJ | 193 | 4,60194 |
| 3iwmZ | 189 | 6,69190 |
| 3jL2X | 220 | 9,47938 |
| 3kfiN | 222 | 9,30139 |
| 3kxVi | 220 | 9,51806 |
| 3lnz5 | 222 | 9,39506 |
| 3lo7h | 225 | 9,94330 |
| 3m5I8 | 222 | 9,41304 |
| 3prpU | 220 | 9,58872 |
| 3qQG8 | 222 | 9,55642 |
| 3qm0E | 222 | 9,75157 |
| 3sQFh | 234 | 9,39422 |
| 3sQJs | 220 | 9,58872 |
| 3sTsx | 220 | 9,51897 |
| 3tDjz | 190 | 9,39499 |
| 3w5NN | 222 | 9,39506 |
| 40but | 175 | 5,79709 |
| 4FXWF | 188 | 6,74323 |
| 4L9TX | 165 | 6,03314 |
| 4LaZT | 165 | 6,03786 |
| 4Miwc | 169 | 7,04374 |
| 4Mj7i | 183 | 6,99315 |
| 4eZTL | 221 | 5,73314 |
| 4f8U4 | 217 | 9,36534 |
| 4fuqv | 217 | 9,56964 |
| 4yfIl | 225 | 9,23318 |
| 5KuOI | 240 | 9,28495 |
| 5L9Rh | 163 | 7,77877 |
| 5MYDH | 241 | 9,39403 |
| 5McRK | 241 | 9,39467 |
| 5PF3H | 225 | 9,94330 |
| 5QZsj | 240 | 9,28495 |
| 5TakE | 227 | 9,13893 |
| 5UaT8 | 190 | 9,56712 |
| 5Ujh9 | 241 | 9,39467 |
| 5XA1d | 241 | 9,39467 |
| 5XPYr | 241 | 9,39467 |
| 5Xw5I | 238 | 9,57905 |
| 5Y7D1 | 241 | 9,39467 |
| 5Z2h7 | 165 | 7,04198 |
| 5Z4le | 227 | 9,67691 |
| 5ZPnj | 225 | 9,98630 |
| 61LiS | 240 | 9,28495 |
| 63xcQ | 186 | 9,76285 |
| 645YF | 225 | 9,91126 |
| 64p5E | 227 | 9,23492 |
| 67IQY | 225 | 9,94401 |
| 687oY | 241 | 9,39467 |
| 68EDe | 160 | 8,44499 |
| 6Z7lX | 225 | 10,03130 |
| 6bBjH | 240 | 9,39467 |
| 6cuaT | 238 | 9,63894 |
| 6ebnY | 225 | 10,03130 |
| 6fCUC | 190 | 9,39499 |
| 6ft8o | 215 | 9,04216 |
| 6hRrH | 161 | 8,44499 |
| 6kf71 | 241 | 9,47900 |
| 6mBUt | 241 | 9,39467 |
| 6mfwU | 227 | 9,13893 |
| 6mhK9 | 220 | 9,59775 |
| 6rGtc | 241 | 9,39467 |
| 6s36O | 227 | 9,25007 |
| 6tCtg | 225 | 10,12020 |
| 6uHZo | 225 | 9,98630 |
| 6vXAr | 225 | 9,98630 |
| 6vZQx | 241 | 9,47874 |
| 712U1 | 240 | 9,37733 |
| 75er3 | 191 | 6,22855 |
| 7BiqR | 227 | 9,31763 |
| 7DI1I | 175 | 7,63913 |
| 7WOfa | 171 | 6,63887 |
| 7WXLk | 190 | 9,39428 |
| 7XkOu | 236 | 9,46030 |
| 7Y4Qb | 164 | 7,00691 |
| 7nFCL | 191 | 6,22855 |
| 7q3t1 | 200 | 7,09523 |
| 81Li3 | 171 | 5,68074 |
| 81lwC | 163 | 8,42236 |
| 86tY8 | 171 | 6,63751 |
| 87yE3 | 171 | 6,21054 |
| 8bsny | 195 | 6,14199 |
| 8btfy | 195 | 5,85785 |
| 8cDaU | 225 | 10,07971 |
| 8ghes | 190 | 9,39428 |
| 8lcmr | 190 | 9,39428 |
| 8m4HK | 251 | 7,14059 |
| 8mQYs | 168 | 6,14494 |
| 8qVtP | 240 | 9,28385 |
| NAhV | 240 | 9,53663 |
| b2SE | 220 | 9,58872 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_4480
3h5QZ
|
10 | 43,7% | 160 | 1.063E-72 |
| 2 |
phalp2_216
5St5t
|
5 | 80,6% | 145 | 5.177E-69 |
| 3 |
phalp2_31629
4DqpK
|
8 | 31,6% | 212 | 4.981E-27 |
| 4 |
phalp2_28634
8qsKr
|
11 | 33,3% | 201 | 9.702E-23 |
| 5 |
phalp2_25593
3WFbK
|
1 | 33,7% | 154 | 9.734E-21 |
| 6 |
phalp2_27718
6SAtZ
|
6 | 31,1% | 196 | 3.839E-19 |
| 7 |
phalp2_33390
6Q97d
|
9 | 27,2% | 191 | 7.074E-19 |
| 8 |
phalp2_9448
ugTX
|
6 | 29,8% | 208 | 5.053E-17 |
| 9 |
phalp2_2348
4TuWR
|
59 | 26,4% | 185 | 1.426E-15 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5QSR9)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50