Protein
- Protein accession
- 6iU5l [EnVhog]
- Representative
- 4MhZ3
- Source
- EnVhog (cluster: phalp2_33124)
- Protein name
- 6iU5l
- Lysin probability
- 85%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKVSSHGIALIQNFEGLRTTAYKPVSNENGWTIGYGHHGPDVKKDSICTEIEAERLLKLDLEKVERQITAALNADEIEVTQGMFDALCSLLFNLSGKRTKDGRQLTPIQTLISYKLWAKMKKGDKYGASLEFLDINKAGGVVLQGLTKRRQAEQKLFLS
- Physico‐chemical
properties -
protein length: 159 AA molecular weight: 17740,2 Da isoelectric point: 9,04 hydropathy: -0,35
Representative Protein Details
- Accession
- 4MhZ3
- Protein name
- 4MhZ3
- Sequence length
- 195 AA
- Molecular weight
- 21974,63190 Da
- Isoelectric point
- 5,18948
- Sequence
-
MTTSDYGREKIENFEGCVLHAYKARPAEKYWTIGYGHYGPDVKEDQTITQQEADALFKQDLKSREQAVDALGIELNQWQFDALVDFAYNCGIGALQSVCKSKDLGEICKLIPNWCKDASGKVLEGLVNRRAWEVSMISPGTIKKGKCIADCLNIRRKAGMDGEICGSYHEGDEVEVLDEWIQTPRGWVASRYIQQ
Other Proteins in cluster: phalp2_33124
| Total (incl. this protein): 118 | Avg length: 189,2 | Avg pI: 7,94 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4MhZ3 | 195 | 5,18948 |
| 13qOH | 222 | 8,04425 |
| 13txz | 206 | 9,03255 |
| 1DmuH | 150 | 5,51039 |
| 1EqkI | 146 | 4,52407 |
| 1Io9h | 158 | 7,79025 |
| 1eZSr | 232 | 8,80743 |
| 1zIBC | 189 | 8,87228 |
| 2VioU | 201 | 6,91113 |
| 2aqyn | 149 | 8,68017 |
| 38GLE | 158 | 8,45221 |
| 3AGez | 159 | 8,81549 |
| 3PBbi | 195 | 5,64800 |
| 3WJfw | 158 | 7,75229 |
| 3caC3 | 237 | 9,08439 |
| 3icX6 | 158 | 8,45221 |
| 3nPz8 | 220 | 7,60173 |
| 3zStR | 146 | 4,74983 |
| 45ugM | 212 | 9,37707 |
| 4BPmT | 150 | 7,66146 |
| 4EDu6 | 208 | 9,00038 |
| 4EmtB | 147 | 6,31239 |
| 4GdF2 | 149 | 8,69222 |
| 4GgHM | 149 | 8,83960 |
| 4Gitg | 149 | 8,89762 |
| 4L1y2 | 151 | 8,25513 |
| 4L9Dw | 160 | 7,75718 |
| 4LBf3 | 206 | 9,97669 |
| 4MRAW | 208 | 9,95045 |
| 4T4Ke | 145 | 4,76779 |
| 4Tucj | 210 | 9,68774 |
| 4XFcK | 151 | 5,12241 |
| 4kh0Z | 196 | 9,36914 |
| 5K6sz | 160 | 8,83160 |
| 5LlZ1 | 159 | 8,47748 |
| 5T5FG | 199 | 6,11431 |
| 5U2UX | 159 | 9,01921 |
| 5WDwC | 160 | 9,05570 |
| 5WONN | 159 | 9,01901 |
| 5Wwts | 199 | 7,75064 |
| 5XF0z | 199 | 5,85415 |
| 5XJnB | 160 | 6,90778 |
| 5YmgZ | 160 | 9,43819 |
| 5iomz | 235 | 8,59629 |
| 5iqAt | 234 | 6,84156 |
| 60r9g | 160 | 8,50436 |
| 62n5m | 160 | 8,83160 |
| 64m4I | 251 | 5,46350 |
| 68xYW | 160 | 9,00187 |
| 69HSr | 201 | 6,52690 |
| 69Ug1 | 160 | 9,32124 |
| 69gGT | 199 | 7,72740 |
| 6ERki | 160 | 9,15233 |
| 6IVzx | 145 | 5,18840 |
| 6OSGn | 150 | 4,30552 |
| 6SyWz | 207 | 9,51684 |
| 6aRK3 | 159 | 8,78480 |
| 6dvHL | 199 | 6,52582 |
| 6ezpZ | 199 | 5,85785 |
| 6icA5 | 160 | 8,50423 |
| 6k9Zs | 159 | 9,27818 |
| 6kBsR | 199 | 6,44181 |
| 6mAL0 | 159 | 9,01921 |
| 6nLm7 | 160 | 8,83160 |
| 6oWbV | 199 | 6,44096 |
| 6tG0V | 159 | 9,03655 |
| 6w9pv | 160 | 8,39374 |
| 76MCH | 202 | 9,28391 |
| 7WOgf | 219 | 9,66176 |
| 7Y5Nw | 201 | 6,96689 |
| 7YBdU | 224 | 8,35673 |
| 7YxOk | 158 | 7,76315 |
| 7cYQ7 | 208 | 8,57470 |
| 7dVIu | 206 | 9,44973 |
| 7kdiD | 210 | 8,28601 |
| 7kdis | 209 | 8,57360 |
| 7mBI6 | 201 | 9,20230 |
| 7ofmR | 201 | 6,58999 |
| 7ofmX | 201 | 6,59965 |
| 7q0nL | 211 | 6,95939 |
| 7q2Up | 158 | 6,90806 |
| 7qGS2 | 145 | 5,89440 |
| 7qGTm | 145 | 7,75030 |
| 7vBb5 | 207 | 9,09676 |
| 7vnHX | 214 | 8,74631 |
| 7vob3 | 215 | 8,90439 |
| 7x2Oh | 215 | 9,11991 |
| 7xIW5 | 206 | 8,85900 |
| 7xReK | 204 | 6,62353 |
| 7xkDN | 211 | 8,54691 |
| 7xkkk | 206 | 9,25516 |
| 7yYAV | 207 | 9,13796 |
| 7yYGR | 209 | 9,04512 |
| 7yzci | 205 | 9,40769 |
| 7yzh0 | 204 | 9,17000 |
| 7zIOZ | 208 | 9,02224 |
| 7zK3w | 215 | 9,11991 |
| 7zeD9 | 206 | 8,96086 |
| 82A4u | 244 | 5,17874 |
| 82obE | 232 | 4,53987 |
| 82obu | 232 | 4,94422 |
| 82rPm | 245 | 4,87709 |
| 889jJ | 219 | 9,42033 |
| 8bsZ1 | 190 | 8,31998 |
| 8dlan | 199 | 6,44096 |
| 8fuxC | 201 | 5,97977 |
| 8lp1K | 216 | 9,33942 |
| 8ob4o | 201 | 7,72740 |
| 8opKj | 232 | 5,22955 |
| 8qWQY | 219 | 9,37166 |
| 8rKQP | 160 | 9,32144 |
| 8rZb5 | 219 | 9,36379 |
| blu4 | 165 | 8,60274 |
| edMi | 189 | 8,69435 |
| fq7X | 213 | 8,26589 |
| nuv8 | 219 | 8,51751 |
| ocp6 | 227 | 9,22254 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_40316
3fQk2
|
50 | 50,6% | 144 | 1.680E-68 |
| 2 |
phalp2_34307
3A2Hz
|
178 | 43,7% | 160 | 4.199E-58 |
| 3 |
phalp2_2498
5GMvl
|
297 | 37,8% | 190 | 3.125E-55 |
| 4 |
phalp2_23833
1mogV
|
302 | 42,4% | 146 | 8.035E-55 |
| 5 |
phalp2_28113
7zmZV
|
50 | 36,6% | 218 | 5.313E-54 |
| 6 |
phalp2_17145
2TusA
|
116 | 44,3% | 142 | 4.811E-53 |
| 7 |
phalp2_33221
5jbqV
|
447 | 46,2% | 147 | 9.029E-53 |
| 8 |
phalp2_33932
23JqA
|
85 | 30,9% | 236 | 5.967E-52 |
| 9 |
phalp2_24016
7V0GL
|
4 | 42,5% | 141 | 6.056E-49 |
| 10 |
phalp2_16385
5LDDR
|
25 | 43,2% | 148 | 5.477E-48 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4MhZ3)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50