Protein

Protein accession
6i8mP [EnVhog]
Representative
1jXPT
Source
EnVhog (cluster: phalp2_39912)
Protein name
6i8mP
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKYGIDVSEWQKGFDFRLAKSQGKSFCIVRAGRTTAAGQPVMDEDFYENINGAKRAGLDVGIYYYSLATTKEIAFREADWIHKLLNSDLRNTALKSGIWIDVEDPKQAKLSPERLTSVIMAGINQLNSYGHYVGIYSSCSFFRNNLVLKNLPGYIPLWVAQYGKENTLKKLYPRKTISAWQYSDRGKIGNNTVDLNIWY
Physico‐chemical
properties
protein length:199 AA
molecular weight:22684,6 Da
isoelectric point:9,28
hydropathy:-0,38
Representative Protein Details
Accession
1jXPT
Protein name
1jXPT
Sequence length
239 AA
Molecular weight
25737,79110 Da
Isoelectric point
4,48934
Sequence
VTIPGIDVSNWNGVIDFPAVAASGVQFGIAKASEGLTYRDPYFAANWRGMKAAGLARGCYHFARPSRNTPEAEADYFLSIVTDLQPGDVLALDMEDEHATGDLSGWALTWLQHVEAAAGCRPLFYSGMWHMVPHGLQTSALADYGLWLASYQAVEPPTPAPWPFLAAWQHSSSGAVPGISGPVDLDIFNGTIDQFLQYGVPVPVVKVPDNNDLIYMVKQIASDPPNLAGLQEALVPFVP
Other Proteins in cluster: phalp2_39912
Total (incl. this protein): 300 Avg length: 259,9 Avg pI: 6,60

Protein ID Length (AA) pI
1jXPT 239 4,48934
11gDD 272 6,21781
12k8E 280 5,84660
12kxW 287 8,47335
16ELN 290 7,83441
17ndF 280 5,81215
18L0Y 227 5,89434
19wAo 254 6,24026
1ASLJ 196 5,54688
1CPLu 224 6,37275
1D0Tq 222 6,51201
1D4We 281 4,59585
1H1Q3 258 7,66561
1RphS 283 7,15980
1STyM 283 7,16066
1VIyp 283 7,15980
1W8He 276 6,72118
1WgKC 283 9,08600
1Wixu 280 7,60894
1WsGz 283 8,26615
1boxn 215 10,05637
1elre 286 8,00054
1g7ov 242 6,12670
1g9vO 277 6,31813
1iWMa 213 5,32180
1jLpw 258 7,04550
1l57X 237 9,01805
1lS37 235 7,80475
1mDJ0 215 5,94623
1n5P2 280 5,30248
1olCU 233 6,60011
1rOjD 280 5,09354
1rPBK 294 5,28156
1rPmt 294 5,62293
1zT2p 264 6,16597
20qXS 218 4,71465
2AxpQ 283 6,01433
2BVSP 283 8,88563
2BXTG 280 6,90499
2BkMf 264 8,65445
2C4Fz 267 8,91038
2G2g8 323 8,71144
2Gtod 266 6,54850
2Kd0d 288 4,87613
2Ts0T 215 5,42502
2TuiE 215 5,62794
2ZHP7 280 5,90110
2acTp 275 9,37069
2bEFp 217 6,69355
2cIV9 233 9,67691
2ey17 280 8,02208
2jpn9 280 8,46033
2js52 286 7,14179
2q1Ph 270 5,92503
2rxaL 294 5,49624
2uuDH 305 6,26544
2wF8I 276 7,73609
2y5Uo 285 6,32944
2y9HE 286 5,98505
2yHpq 281 6,03109
2yLmJ 280 5,15316
2yd4j 286 5,16345
2ydOU 275 6,79899
2ye64 301 5,84131
2zAkm 287 6,17308
2zmDq 285 6,66701
2zuOZ 279 6,53480
2zyVh 286 6,23458
35Dve 234 4,84361
35GP9 277 5,16385
38xbT 229 9,70502
3Ax4T 203 4,33797
3BCN4 275 6,75943
3EMGq 294 6,02518
3ExR4 271 5,25052
3H5qa 300 6,82730
3H9ha 285 6,45233
3HlwF 286 5,74298
3HzJE 277 5,04130
3Jpt7 287 5,23529
3KdFf 214 7,82042
3Kh16 278 8,97556
3L7PQ 306 5,35931
3QB1Y 215 9,18566
3R0Dd 280 8,53956
3RZr0 218 5,92373
3SKpu 276 5,66352
3SMvA 290 8,51674
3SNTH 290 8,85926
3TYLN 257 5,84222
3TYMY 290 8,63768
3UOGe 204 4,45870
3cLId 213 8,82348
3d5kh 215 5,82994
3dyE1 286 5,93123
3fcA3 290 5,00288
3g3oG 273 5,24990
3i9T4 245 4,88403
3lw4f 260 8,67198
3mUEZ 224 6,29659
3oLcc 277 4,83287
3zaPC 201 4,65275
44UYl 230 7,56205
44W9w 286 8,66444
44Zcz 215 5,22347
45DZW 239 5,95919
45NSa 279 5,42064
47hei 217 6,42686
4Beye 286 5,39609
4COWQ 210 8,39432
4ETIE 215 4,48985
4Eb3v 220 5,61293
4EowB 220 4,44591
4EzIn 234 5,23086
4EzMk 220 6,27999
4EzN7 219 8,89768
4F3Zd 207 5,86223
4GPaX 326 10,04271
4H6ZT 253 5,01021
4HA8D 319 4,98855
4Idmm 206 4,40374
4IoDs 278 5,00458
4IwaQ 203 4,68981
4K1L4 235 6,02757
4K1W3 257 5,49829
4K2jU 232 5,25854
4K3wt 213 5,30299
4KEJD 255 4,92859
4KFvp 326 6,20417
4Lo5w 273 5,34618
4LzRc 275 5,50136
4PToY 277 5,83653
4PUN9 286 5,24194
4QaZO 259 4,76290
4RoiH 224 4,91631
4SpU4 275 8,66244
4TH3q 288 4,63240
4W6MO 220 4,74483
4WK59 280 5,66318
4XjRA 294 5,12099
4dYBj 293 5,71558
4dqlc 199 8,89807
4frco 221 7,95883
4ksEI 289 5,22387
4vYxj 253 5,41678
4vZrR 237 5,62811
4wySa 282 8,56432
4wyUM 286 5,78924
4wzAb 295 4,89505
4wzC7 286 5,16237
4wzPt 286 5,52227
4wzk3 295 5,19056
4xrZV 215 6,14506
5FiQK 283 7,02248
5Fouu 216 9,68691
5Hygo 220 5,16936
5Nwg 215 5,44997
5i2HG 259 5,29105
5i4y1 267 6,42607
5jcZQ 217 10,09048
5nILz 220 5,04988
5qXIc 287 6,96786
5sEGF 283 7,07778
5uckg 220 5,50795
5zyA7 290 9,06982
6DLg5 205 8,09628
6DqCW 307 7,25558
6EDJK 205 8,09628
6H53x 314 8,26667
6HmiA 272 4,57141
6IMGl 230 5,39416
6Ifdd 155 5,49505
6Jhpv 200 4,50781
6KL3h 238 5,00447
6Lehl 227 5,28258
6NUez 219 5,44020
6Qe3o 209 5,10905
6SKj9 288 4,68111
6SNww 317 7,62674
6U6EH 260 8,87190
6VS8u 246 4,99805
6VVvx 284 5,99716
6WGcX 224 4,50514
6WksU 244 5,43025
6XMsb 200 4,76114
6Xpgg 243 5,40206
71G90 180 9,11855
71zhP 216 5,20937
728RT 200 7,83634
742L1 257 7,65521
75bkd 272 9,61934
7BDlJ 269 7,75042
7BDmm 261 6,20514
7DnI1 279 6,71021
7KOcW 199 5,76242
7KOdj 198 4,64604
7LAKN 274 9,16981
7SQe9 313 6,71305
7SZqv 279 9,19643
7TeAt 288 5,55819
7TfF0 288 5,33749
7TigI 288 5,24507
7Ttzx 271 5,22461
7TyE5 283 5,31799
7UdLc 274 5,28417
7VKty 281 6,96519
7VLaU 279 9,14060
7VOeu 282 6,96723
7WdZU 254 5,01589
7ZJfc 196 4,88869
7aR0M 199 9,17728
7c6K8 257 7,68272
7c6L9 258 8,52609
7c6LE 190 9,62985
7hBKF 307 8,59617
7pYYA 261 6,06094
7pdeZ 260 8,75431
7ptfP 286 8,48979
7ruZR 306 6,76017
7ruZm 306 8,58598
7rxmz 261 6,05895
7sPKj 257 8,24269
7sQwk 205 6,96564
7w0uU 275 7,76554
7wCRb 257 7,16481
7y04R 257 8,17312
840OJ 283 8,96325
849Ht 286 5,05892
86FqR 214 9,12113
86LrL 222 4,25311
8712F 215 6,40356
8As6p 280 5,17800
8CzH9 275 8,89053
8DAZC 283 7,69551
8DDJq 286 8,18396
8EVrh 283 9,00548
8FepV 280 5,09354
8Gata 288 5,65130
8GeFq 277 5,84512
8K2v6 275 9,41852
8aggk 225 9,36295
8crBm 274 7,71972
8eDt5 283 6,01586
8m9FN 249 4,58875
8m9tr 250 4,63456
8m9xQ 276 4,77700
8m9z8 272 4,63280
8madM 250 4,66014
8mbCX 250 4,79411
8mbt9 253 4,75563
8u5va 282 6,53708
8uwQn 287 6,97053
8uynJ 275 8,89053
8v3ot 288 5,55819
8yUpW 278 4,83702
9yY0 287 6,30921
9zbk 294 5,74093
El1O 280 5,24819
EoWn 295 4,83952
Etsx 280 5,34215
P02x 283 8,25900
P2ZQ 222 6,33473
P3JE 285 8,76146
P4yH 283 9,23415
PT24 295 5,90264
PaQs 286 6,18564
Pmfu 283 8,54646
QLqq 207 7,09165
R2eL 267 8,66876
VWea 267 8,68010
VlFf 294 5,77242
Vo8r 277 8,81768
WIjK 271 5,47345
YKoT 285 7,63719
YW4l 286 6,10555
Z1hB 279 7,61417
ZBLo 236 8,50269
aTkZ 201 4,54674
bhaR 297 9,97392
cuGj 286 8,59668
cuLg 286 8,62150
cv2t 285 9,13409
cvZT 280 8,19582
cwJJ 267 8,60261
cxlX 283 8,73696
cxsa 283 5,70802
f5ga 220 4,77916
fB9V 242 4,95746
fg0Z 253 4,70976
fimz 221 6,41379
fojh 258 8,56767
fqei 263 6,25208
gtdn 286 5,37341
iepb 244 4,48513
jHkq 230 8,85211
kaNg 213 6,83139
lF2I 207 5,62248
vVN0 281 6,55174
zDXS 283 8,53853
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_5615
4g2xP
40 41,1% 204 7.219E-70
2 phalp2_36157
6TiaL
25 41,0% 195 3.478E-69
3 phalp2_10644
2AeOK
60 43,6% 190 2.563E-66
4 phalp2_20360
2RVWF
69 43,7% 192 9.011E-66
5 phalp2_30061
2NCcc
23 41,7% 218 1.376E-63
6 phalp2_35314
79Mal
26 35,1% 199 2.328E-62
7 phalp2_26214
jZqY
82 30,7% 228 1.246E-56
8 phalp2_34559
4UNXW
287 42,5% 202 2.875E-55
9 phalp2_5862
5yfd0
6 31,0% 222 1.890E-54
10 phalp2_32129
6Dieh
5 33,6% 190 8.155E-53

Domains

Domains
Representative sequence (used for alignment): 1jXPT (239 AA)
Member sequence: 6i8mP (199 AA)
1 239 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01183

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1jXPT) rather than this protein.
PDB ID
1jXPT
Method AlphaFoldv2
Resolution 91.09
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50