Protein
- Protein accession
- 6g1Ay [EnVhog]
- Representative
- 4H4oF
- Source
- EnVhog (cluster: phalp2_39380)
- Protein name
- 6g1Ay
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MNIVKNNFTFKHMDKLNPNKVLLVVFHHRGGNGDVQSIHQQHLKQGWAGIGYHYYIRKDGKVYQGRPIQYVGSHCKGNNSCSIGVCLEGNFSKEFPTDEQLISCVEIYKWIKKMYPRIYKAVNHRDLSPTACPCYPLAEYVNQRKS
- Physico‐chemical
properties -
protein length: 146 AA molecular weight: 16876,2 Da isoelectric point: 9,39 hydropathy: -0,58
Representative Protein Details
- Accession
- 4H4oF
- Protein name
- 4H4oF
- Sequence length
- 171 AA
- Molecular weight
- 18800,88000 Da
- Isoelectric point
- 6,14210
- Sequence
-
MQSFDVIGPQITDISMELERGPTPYTTRGASAIQRIVIHHTATPASTTPQAIARYHVRERGWPGIGYHYVIAADGTVYQTNPPTSVSYHVRAFNPESIGIALVGDFTAEPPPAAQLRAAAELIRSIRSLLGRELPVFGHRDLNATQCPGNTWHEWRRTLTSMIEGEQDGEA
Other Proteins in cluster: phalp2_39380
| Total (incl. this protein): 116 | Avg length: 161,1 | Avg pI: 8,24 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4H4oF | 171 | 6,14210 |
| 10vEA | 160 | 8,32463 |
| 16HW1 | 164 | 9,23041 |
| 16aMY | 160 | 6,74840 |
| 17a9h | 170 | 7,68136 |
| 1HOlU | 165 | 9,20152 |
| 1HQDi | 165 | 8,37775 |
| 1Nwz9 | 187 | 10,19827 |
| 1cuOD | 138 | 9,04577 |
| 1gHEE | 151 | 9,25858 |
| 1hj2S | 160 | 6,70310 |
| 1hm5O | 159 | 5,11479 |
| 1oWLQ | 166 | 9,67169 |
| 1zJW7 | 169 | 5,10274 |
| 2GVAu | 99 | 6,25368 |
| 2HUiA | 156 | 9,21171 |
| 2KJnJ | 185 | 6,38640 |
| 2TY2L | 210 | 5,39387 |
| 2VmWq | 138 | 9,03043 |
| 2afZ4 | 151 | 6,84747 |
| 2tKkV | 201 | 7,59007 |
| 2vFFG | 140 | 9,02082 |
| 330a0 | 162 | 9,36708 |
| 330s9 | 152 | 6,61386 |
| 37Wd6 | 186 | 8,44170 |
| 37Ws5 | 149 | 9,26909 |
| 38ILq | 151 | 9,17045 |
| 3D9L | 140 | 9,46159 |
| 3FWsS | 143 | 9,05550 |
| 3K4fn | 143 | 8,78222 |
| 3NBo7 | 180 | 6,45261 |
| 3S0A7 | 137 | 6,81246 |
| 3TVE5 | 169 | 9,80630 |
| 3U2zx | 186 | 10,24320 |
| 3XoYz | 212 | 10,48612 |
| 3ZpuU | 158 | 5,95266 |
| 3aXWU | 205 | 7,08517 |
| 3duN | 170 | 6,53656 |
| 3mXXI | 200 | 4,92580 |
| 3ofXx | 185 | 6,44414 |
| 401sK | 147 | 9,56887 |
| 40ESS | 148 | 9,60690 |
| 42imN | 169 | 9,95806 |
| 48urN | 197 | 6,02939 |
| 4Cad9 | 158 | 6,14830 |
| 4Hozz | 180 | 9,58369 |
| 4USSl | 177 | 9,79940 |
| 4VjXN | 159 | 7,77236 |
| 4itlO | 163 | 10,32128 |
| 4jNim | 152 | 8,42339 |
| 4jwW7 | 185 | 6,16569 |
| 4sBWQ | 152 | 6,45869 |
| 4tmHG | 158 | 8,24004 |
| 4xNL8 | 193 | 6,11794 |
| 4yDS0 | 158 | 6,64933 |
| 4yDfc | 161 | 6,78944 |
| 5Dmod | 177 | 9,56887 |
| 5RBj3 | 148 | 9,40408 |
| 5RLOJ | 147 | 9,44044 |
| 5Sy99 | 146 | 9,38990 |
| 5T4pZ | 147 | 9,55481 |
| 5U3Un | 144 | 9,62830 |
| 5UQCc | 146 | 9,58460 |
| 5hRUU | 117 | 9,19566 |
| 5nhGL | 169 | 10,11794 |
| 5rJs9 | 144 | 9,25942 |
| 61rJ5 | 194 | 5,48612 |
| 63qBz | 148 | 9,23550 |
| 6RhLB | 183 | 9,20623 |
| 6Vqv0 | 143 | 6,74192 |
| 6e4hV | 146 | 9,42504 |
| 6gSv2 | 146 | 9,33272 |
| 6nVPG | 146 | 9,49176 |
| 6nZAO | 153 | 7,73263 |
| 6vNt4 | 145 | 9,11191 |
| 6vk3b | 152 | 9,53134 |
| 6vtNI | 144 | 9,58163 |
| 7CsOm | 174 | 9,91538 |
| 7HThb | 188 | 7,19106 |
| 7Thjc | 143 | 7,71535 |
| 7TlJH | 143 | 7,10973 |
| 7VSdf | 156 | 9,11062 |
| 7xZGi | 147 | 9,69206 |
| 80tDS | 139 | 9,06724 |
| 81f3R | 156 | 6,70520 |
| 82ZmI | 170 | 6,49393 |
| 82ppB | 150 | 8,57328 |
| 82q14 | 195 | 8,96003 |
| 83CyK | 139 | 9,06724 |
| 84clq | 159 | 9,61947 |
| 85u3T | 138 | 7,15673 |
| 89LDf | 150 | 8,69422 |
| 8EBlu | 140 | 8,88189 |
| 8GtvU | 185 | 6,44414 |
| 8chQN | 143 | 6,74192 |
| 8dsZg | 137 | 6,79080 |
| 8fwsS | 151 | 9,41208 |
| 8hwVU | 142 | 9,30074 |
| 8jW1S | 140 | 9,46159 |
| 8kyl3 | 174 | 8,38104 |
| 8niJc | 169 | 7,82300 |
| 8pPX3 | 152 | 7,12485 |
| 8rzCy | 183 | 6,73908 |
| 8t917 | 180 | 9,09844 |
| 8txXc | 185 | 6,23901 |
| 9TJc | 185 | 7,22022 |
| BtmQ | 180 | 5,96204 |
| b6J2 | 182 | 8,28878 |
| ipVw | 158 | 8,24230 |
| jyYE | 140 | 9,46159 |
| s3XF | 140 | 9,46159 |
| vj6W | 210 | 8,97576 |
| A0A088FLK9 | 156 | 9,67511 |
| A0A3Q8I6A1 | 171 | 9,37423 |
| W0FBY3 | 155 | 9,29971 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_25442
2RRxP
|
189 | 42,6% | 136 | 3.012E-49 |
| 2 |
phalp2_12934
2XGYf
|
62 | 49,2% | 128 | 5.658E-49 |
| 3 |
phalp2_37356
8qdpv
|
23 | 44,3% | 142 | 1.456E-48 |
| 4 |
phalp2_35354
7vHgi
|
29 | 42,1% | 121 | 9.879E-45 |
| 5 |
phalp2_19793
4W5p2
|
179 | 39,8% | 128 | 1.009E-41 |
| 6 |
phalp2_28697
4ATEG
|
42 | 32,7% | 162 | 1.383E-41 |
| 7 |
phalp2_22703
865Sd
|
18 | 34,2% | 146 | 4.873E-41 |
| 8 |
phalp2_3586
4HvU7
|
4 | 44,1% | 154 | 6.050E-40 |
| 9 |
phalp2_15837
4idZC
|
2 | 40,3% | 156 | 2.920E-39 |
| 10 |
phalp2_30567
5IVuf
|
14 | 35,7% | 151 | 7.507E-39 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4H4oF)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50