Protein
- Protein accession
- 6fZTT [EnVhog]
- Representative
- 8mZo1
- Source
- EnVhog (cluster: phalp2_31263)
- Protein name
- 6fZTT
- Lysin probability
- 86%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MRTTTGTKNRIKKFEGLRLAAYVCAAGVCTIGYGHTAGVKPGDVITEAQADAFFESDIRAVENQVNALPLHLGQYQFDAVVSFCFNVGIGKFKKSTLYKKIRADAYDSSIPAEFKKWIYGGGKILPGLVTRREWEAKRYQGLTI
- Physico‐chemical
properties -
protein length: 144 AA molecular weight: 15930,2 Da isoelectric point: 9,49 hydropathy: -0,17
Representative Protein Details
- Accession
- 8mZo1
- Protein name
- 8mZo1
- Sequence length
- 143 AA
- Molecular weight
- 15919,93780 Da
- Isoelectric point
- 9,30048
- Sequence
-
MKISENGLKLIKSFEGCRLTAYKDSVGIWTIGYGTTNADKAITGATICQGLQISQETADEWLRQSVDKKYGPKVEKYNAAYGWNQNEFDALVSFAYNIGSIDQLTANGTRSRSMIAEKILQYNKAGGKMKMVNGHSTYQMVRK
Other Proteins in cluster: phalp2_31263
| Total (incl. this protein): 167 | Avg length: 149,0 | Avg pI: 8,97 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8mZo1 | 143 | 9,30048 |
| 12YFM | 156 | 7,70637 |
| 12ZeQ | 156 | 7,69619 |
| 15uvx | 157 | 9,35960 |
| 16EhF | 156 | 6,58459 |
| 1FSbY | 144 | 9,53908 |
| 1IhUp | 199 | 4,77228 |
| 1LQOL | 147 | 9,08097 |
| 1Laf7 | 149 | 9,55758 |
| 1LbkM | 178 | 9,43632 |
| 1LrE9 | 149 | 9,55758 |
| 1Mnab | 149 | 9,47423 |
| 1Msmy | 149 | 9,55758 |
| 1Mx9q | 147 | 9,08097 |
| 1gybP | 190 | 9,15343 |
| 1m7Sf | 144 | 9,53844 |
| 1neVF | 144 | 9,35844 |
| 1r6fm | 146 | 10,24875 |
| 20wZ7 | 150 | 9,46565 |
| 24SJg | 156 | 5,48595 |
| 25hyC | 148 | 8,60687 |
| 2Bdu8 | 150 | 9,42259 |
| 2BpWV | 150 | 9,26116 |
| 2CAYF | 147 | 8,97853 |
| 2CDlt | 150 | 9,50614 |
| 2CmLx | 150 | 9,25903 |
| 2UkOE | 156 | 9,99507 |
| 2Y98e | 193 | 4,83776 |
| 2YlRE | 149 | 9,40241 |
| 2ZQAP | 155 | 9,68336 |
| 2cvRV | 151 | 6,61835 |
| 2dhqd | 122 | 9,45398 |
| 2lQ0d | 144 | 9,70902 |
| 30nfY | 182 | 7,69125 |
| 31S1C | 149 | 9,51619 |
| 366jU | 151 | 5,07040 |
| 36Sg2 | 145 | 9,19495 |
| 3704g | 149 | 9,42272 |
| 3NOee | 151 | 6,05133 |
| 3bn3S | 157 | 6,82127 |
| 3bpZG | 157 | 6,82042 |
| 3c0uR | 206 | 10,61287 |
| 3cH4V | 157 | 9,84872 |
| 3fXZR | 164 | 4,83804 |
| 3gGtd | 120 | 4,79820 |
| 3jKGz | 144 | 9,53876 |
| 3jKds | 144 | 9,37991 |
| 3kP8Y | 126 | 9,37862 |
| 3kX99 | 112 | 6,27732 |
| 3m8yI | 144 | 9,35850 |
| 3mcM8 | 144 | 9,35876 |
| 3oUjR | 144 | 9,53876 |
| 3oYpT | 125 | 9,38068 |
| 3p9ve | 144 | 9,46572 |
| 3pfz1 | 144 | 9,56268 |
| 3tyFE | 144 | 9,46572 |
| 3w03E | 144 | 9,70941 |
| 3wvqm | 144 | 9,37991 |
| 48hVY | 152 | 9,12010 |
| 49uKi | 149 | 9,51619 |
| 4Gb14 | 150 | 9,56293 |
| 4GdOy | 155 | 9,55726 |
| 4HYM9 | 168 | 7,78161 |
| 4Wqdo | 151 | 8,55787 |
| 4YqWb | 150 | 9,68336 |
| 4aaI8 | 149 | 9,56293 |
| 4qMps | 150 | 9,53876 |
| 4tSYy | 150 | 9,68762 |
| 4ybOU | 158 | 9,83299 |
| 4yqqk | 164 | 6,85043 |
| 4yriL | 164 | 6,85043 |
| 53LHg | 149 | 9,47423 |
| 56qz3 | 121 | 7,91628 |
| 57O9o | 150 | 9,46533 |
| 5KE15 | 144 | 9,62663 |
| 5KXMj | 144 | 9,53876 |
| 5KXWc | 144 | 9,53876 |
| 5LVKh | 139 | 10,13490 |
| 5MPn6 | 144 | 9,46572 |
| 5MaUq | 144 | 9,53876 |
| 5MdFP | 137 | 9,32414 |
| 5Nlhh | 144 | 9,53876 |
| 5OKLh | 119 | 5,43434 |
| 5OVn9 | 144 | 9,53876 |
| 5QeKP | 144 | 9,25722 |
| 5RHzm | 144 | 9,62663 |
| 5S3vs | 144 | 9,53876 |
| 5Vl9n | 144 | 9,53876 |
| 5YGiX | 154 | 8,94094 |
| 5f0Le | 150 | 9,49466 |
| 5g1TZ | 155 | 9,57886 |
| 5giAf | 149 | 9,47423 |
| 5hTtu | 142 | 9,81223 |
| 5hW2s | 142 | 9,81223 |
| 5hYPm | 142 | 9,85098 |
| 5hZcx | 193 | 5,62657 |
| 5i0nN | 142 | 9,65951 |
| 5iEqj | 178 | 9,41840 |
| 5inYX | 142 | 9,53960 |
| 5kzO0 | 151 | 6,51252 |
| 5lMjZ | 149 | 9,55758 |
| 60Uip | 144 | 9,46572 |
| 60dTi | 165 | 9,98494 |
| 616LO | 144 | 9,58846 |
| 63WH9 | 139 | 10,09931 |
| 64QXB | 144 | 9,56268 |
| 688pN | 144 | 9,62656 |
| 6APPD | 150 | 9,56293 |
| 6WGZG | 153 | 5,10883 |
| 6a7Ru | 144 | 9,46597 |
| 6aCW3 | 170 | 9,56016 |
| 6atdU | 144 | 9,46572 |
| 6bVCM | 91 | 8,57889 |
| 6cZH4 | 144 | 9,62656 |
| 6dOiK | 216 | 8,27047 |
| 6geWw | 144 | 9,62663 |
| 6hatA | 144 | 9,44335 |
| 6ijeO | 152 | 9,49331 |
| 6jUsg | 144 | 9,37991 |
| 6kPzj | 139 | 10,13490 |
| 6kxcf | 165 | 10,00802 |
| 6nMxY | 144 | 9,46572 |
| 6nMz0 | 144 | 9,53876 |
| 6nlth | 144 | 9,56268 |
| 6oPmW | 144 | 9,58846 |
| 6oz3d | 144 | 9,46533 |
| 6qxgd | 144 | 9,44386 |
| 6rmXM | 144 | 9,70941 |
| 6s2WQ | 91 | 7,71341 |
| 6sxIz | 137 | 9,16091 |
| 6tdCs | 144 | 9,46572 |
| 6twze | 144 | 9,53876 |
| 6u6sO | 144 | 9,53844 |
| 6udhs | 144 | 9,56268 |
| 6wNtQ | 144 | 9,53876 |
| 6woy3 | 144 | 9,46572 |
| 71tUQ | 144 | 9,67994 |
| 7BHcl | 141 | 10,34648 |
| 7OiGE | 144 | 9,56268 |
| 7xAkT | 144 | 9,67298 |
| 7yZ3T | 145 | 9,14324 |
| 7yZ4z | 145 | 8,88556 |
| 7zxII | 144 | 9,53876 |
| 7zy9A | 144 | 9,53811 |
| 86LCi | 139 | 5,54018 |
| 8Dg4j | 150 | 9,56300 |
| 8b0ax | 144 | 9,25722 |
| 8fAvX | 142 | 9,81958 |
| 8fItF | 223 | 9,85936 |
| 8fKxE | 140 | 10,22676 |
| 8m3s5 | 144 | 9,46533 |
| 8nQrZ | 139 | 10,07049 |
| 8tBKl | 147 | 8,94185 |
| 9yRG | 169 | 6,41254 |
| H8vv | 152 | 5,27372 |
| LkGX | 149 | 9,56293 |
| Odyc | 156 | 10,17461 |
| OrDO | 144 | 9,56300 |
| TKdc | 153 | 8,77468 |
| YR9a | 150 | 9,58949 |
| goon | 144 | 9,65242 |
| mdZ0 | 117 | 6,25629 |
| o6E1 | 132 | 9,75060 |
| q9Op | 147 | 9,46572 |
| z5N8 | 144 | 9,62624 |
| A0A8S5U878 | 223 | 9,88063 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_33221
5jbqV
|
447 | 45,1% | 135 | 6.255E-43 |
| 2 |
phalp2_4451
31DIk
|
4919 | 40,4% | 136 | 3.139E-39 |
| 3 |
phalp2_9745
82S7v
|
113 | 42,1% | 133 | 3.139E-39 |
| 4 |
phalp2_126
5jCCA
|
637 | 39,2% | 135 | 5.901E-39 |
| 5 |
phalp2_2632
6RhYr
|
14867 | 41,3% | 133 | 1.109E-38 |
| 6 |
phalp2_31530
48EM7
|
20 | 49,4% | 99 | 2.858E-38 |
| 7 |
phalp2_2176
3Yhf4
|
930 | 40,4% | 141 | 1.010E-37 |
| 8 |
phalp2_33124
4MhZ3
|
118 | 46,2% | 132 | 2.602E-37 |
| 9 |
phalp2_34878
4dXDH
|
390 | 39,8% | 128 | 1.784E-33 |
| 10 |
phalp2_31105
1YRHZ
|
456 | 40,4% | 131 | 1.184E-32 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8mZo1)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50