Protein
- Protein accession
- 6fXPT [EnVhog]
- Representative
- 1m3Kq
- Source
- EnVhog (cluster: phalp2_664)
- Protein name
- 6fXPT
- Lysin probability
- 87%
- PhaLP type
-
endolysin
Probability: 95% (predicted by ML model) - Protein sequence
-
MIPVQADIEQGECIRRDPAPYEPITYHVPLDADLQQYTAEMCDLYEVPLELAYAVMQVESGYTVSATSSTGDYGLMQINSINAGWLKDELGVTDLLDAGQNIKAGCYMLGSYLALYDGDINRTMMAYNLGKSGAEKAWNAGIRSTAYTDKVWSAMVGLLEEERDVS
- Physico‐chemical
properties -
protein length: 166 AA molecular weight: 18270,4 Da isoelectric point: 4,15 hydropathy: -0,18
Representative Protein Details
- Accession
- 1m3Kq
- Protein name
- 1m3Kq
- Sequence length
- 166 AA
- Molecular weight
- 18244,28510 Da
- Isoelectric point
- 4,12926
- Sequence
-
MIPVQADIEQGDCIRRDPAPYEPITYHVPLDADLQQYTAEMCDLYEVPLELAYAVMQVESGYTVSATSSTGDYGLMQINSINAGWLKDELGVTDLLDAGQNIKAGCYMLGSYLALYDGDINRTMMAYNLGKSGAEKAWNAGTRSTAYTDKVWSAMVGLLEEERDVS
Other Proteins in cluster: phalp2_664
| Total (incl. this protein): 134 | Avg length: 185,1 | Avg pI: 5,40 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1m3Kq | 166 | 4,12926 |
| 13dXP | 181 | 4,83719 |
| 13yQ4 | 186 | 4,19031 |
| 1Z2Uw | 195 | 8,62189 |
| 1mndi | 190 | 4,67611 |
| 1o7y9 | 223 | 4,47905 |
| 2alZZ | 173 | 4,96434 |
| 2am7U | 174 | 4,51190 |
| 3kTx0 | 204 | 4,30421 |
| 3lMAv | 201 | 6,94904 |
| 3lg1j | 201 | 6,94904 |
| 3mqsc | 201 | 6,95513 |
| 3oQCB | 205 | 4,17740 |
| 3r4XR | 176 | 5,88735 |
| 3rPrO | 215 | 4,78513 |
| 3sCsM | 166 | 4,19133 |
| 3sQNx | 176 | 6,27937 |
| 3sSRX | 163 | 4,14529 |
| 3tYuP | 176 | 5,88735 |
| 3un4F | 204 | 4,26005 |
| 3wLr2 | 204 | 4,32746 |
| 3wYFV | 176 | 6,27545 |
| 3xRo1 | 177 | 4,52390 |
| 3xSel | 173 | 4,53583 |
| 3yEEw | 201 | 6,51013 |
| 40CFw | 197 | 8,96860 |
| 4FWT2 | 174 | 4,66588 |
| 4Mk9J | 206 | 4,60756 |
| 5KA7U | 166 | 4,14523 |
| 5Lqsy | 188 | 6,58334 |
| 5LquL | 166 | 4,14523 |
| 5MOSw | 176 | 5,88735 |
| 5MVo4 | 176 | 5,88735 |
| 5MWeD | 205 | 4,17740 |
| 5Mata | 166 | 4,18661 |
| 5NBHN | 176 | 6,27800 |
| 5NMlv | 166 | 4,18661 |
| 5OSnS | 176 | 4,09476 |
| 5OUaj | 179 | 5,91122 |
| 5OtXH | 176 | 6,28198 |
| 5QQtL | 176 | 5,88735 |
| 5QvuI | 176 | 6,82047 |
| 5RGMo | 176 | 6,81831 |
| 5SQZl | 176 | 6,28210 |
| 5StUs | 176 | 6,28198 |
| 5Stme | 176 | 4,12392 |
| 5TnO3 | 184 | 4,17223 |
| 5UMBT | 167 | 4,10687 |
| 5Ucmg | 225 | 4,78359 |
| 5V9kk | 176 | 6,28210 |
| 5VBnK | 204 | 4,62035 |
| 5VQcy | 166 | 4,21549 |
| 5VaUT | 176 | 6,28198 |
| 5VxyT | 166 | 4,10681 |
| 5Xy9Q | 176 | 5,89474 |
| 5Y0vy | 166 | 4,21793 |
| 5YwSq | 163 | 4,18667 |
| 602mz | 166 | 4,21793 |
| 607TH | 156 | 4,56027 |
| 60PTA | 166 | 4,14626 |
| 60jUR | 201 | 6,51013 |
| 60jbF | 176 | 6,27937 |
| 62hEG | 176 | 5,88735 |
| 63IUI | 166 | 4,10681 |
| 63d0G | 151 | 4,49502 |
| 64ABv | 205 | 4,22145 |
| 66noX | 163 | 4,21679 |
| 674NK | 167 | 4,12932 |
| 685vQ | 225 | 4,90210 |
| 69EXp | 167 | 4,21679 |
| 6Pszt | 190 | 4,21714 |
| 6YTOo | 179 | 5,58559 |
| 6a6DO | 206 | 6,64933 |
| 6aBpE | 203 | 5,20551 |
| 6alRm | 206 | 6,33109 |
| 6bFYM | 176 | 6,28210 |
| 6bW9E | 204 | 4,90540 |
| 6btwa | 176 | 5,88735 |
| 6cu47 | 176 | 6,09691 |
| 6fSWr | 166 | 4,12318 |
| 6fnm5 | 166 | 4,14626 |
| 6hVjd | 176 | 4,20992 |
| 6iV9Y | 204 | 4,83583 |
| 6iyKw | 163 | 4,18667 |
| 6jTbO | 189 | 5,93856 |
| 6jvV3 | 189 | 6,19780 |
| 6k5hM | 205 | 4,30421 |
| 6kif9 | 189 | 6,19780 |
| 6lSvi | 200 | 7,66618 |
| 6lTt8 | 205 | 4,28693 |
| 6lmYa | 176 | 5,88729 |
| 6loY2 | 209 | 5,95891 |
| 6n31h | 176 | 6,27937 |
| 6nJkK | 209 | 5,37904 |
| 6oBCk | 176 | 5,88729 |
| 6oTxV | 166 | 4,07282 |
| 6oZgy | 176 | 5,88735 |
| 6q9Qd | 176 | 5,88735 |
| 6qG1C | 163 | 4,14529 |
| 6sz7A | 192 | 4,85157 |
| 6tqPE | 167 | 4,12227 |
| 6uADv | 166 | 4,12318 |
| 6umUS | 176 | 6,28198 |
| 6uop2 | 176 | 5,88735 |
| 6uqIJ | 163 | 4,12227 |
| 6vhjr | 184 | 6,09777 |
| 70JM8 | 179 | 5,58559 |
| 7VoPo | 204 | 8,75244 |
| 7VolW | 192 | 6,13392 |
| 7XjoN | 204 | 4,30029 |
| 7r3xu | 204 | 4,33047 |
| 7xYb4 | 151 | 4,49297 |
| 80qel | 204 | 4,30029 |
| 84hlm | 195 | 5,95391 |
| 87IjP | 200 | 6,94927 |
| 8cCJ9 | 176 | 5,88735 |
| 8fiWt | 252 | 5,80760 |
| 8hdZV | 204 | 4,33047 |
| 8moWN | 210 | 9,41666 |
| 8mome | 211 | 9,13744 |
| 8oN83 | 236 | 5,81812 |
| 8oegZ | 176 | 5,88735 |
| 8pGuI | 210 | 9,20849 |
| 8pGym | 159 | 5,49544 |
| 8q8U2 | 252 | 5,97829 |
| 8sndG | 210 | 9,15117 |
| 8so2y | 175 | 5,10229 |
| 8vOiy | 176 | 5,88729 |
| OvwT | 179 | 5,58559 |
| ZrLD | 176 | 8,40050 |
| b3gv | 205 | 4,22020 |
| z53x | 163 | 4,14529 |
| A0A8S5THV1 | 205 | 4,33047 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_25545
3xVgg
|
76 | 83,7% | 166 | 8.525E-79 |
| 2 |
phalp2_12998
3nWhM
|
100 | 47,2% | 146 | 7.592E-61 |
| 3 |
phalp2_600
139Z6
|
763 | 47,7% | 134 | 4.299E-55 |
| 4 |
phalp2_26221
naqH
|
11 | 47,6% | 128 | 2.937E-51 |
| 5 |
phalp2_36276
81fJ
|
27 | 46,0% | 139 | 2.426E-49 |
| 6 |
phalp2_17432
7DOMS
|
1 | 38,0% | 150 | 8.795E-46 |
| 7 |
phalp2_5110
1LG8o
|
7 | 39,3% | 132 | 3.586E-40 |
| 8 |
phalp2_31447
3o77A
|
181 | 35,9% | 139 | 1.423E-37 |
| 9 |
phalp2_25082
1gCiB
|
6 | 37,8% | 148 | 1.310E-33 |
| 10 |
phalp2_38443
1dRXY
|
4 | 33,9% | 153 | 7.889E-29 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1m3Kq)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50