Protein
- Protein accession
- 6fJNL [EnVhog]
- Representative
- 3nSFE
- Source
- EnVhog (cluster: phalp2_2134)
- Protein name
- 6fJNL
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 96% (predicted by ML model) - Protein sequence
-
MLTVGYKNSWYPKNYRGQIHYGVDMVHRDGLTTLYGCGDGVVSHCGYDEICGNVLIIKYANCLLKDNRLKNIVVRYFHLDRLNVRVGDKVNIETVLGYYGKTGVQVNGAHLHVECDLDYDYPSFTPCLKGNSNILKASPKGYPDTTIDPTLVFYIKESSPEKQMVGVKYSGSVSQSDLKYDKLR
- Physico‐chemical
properties -
protein length: 184 AA molecular weight: 20745,5 Da isoelectric point: 8,42 hydropathy: -0,35
Representative Protein Details
- Accession
- 3nSFE
- Protein name
- 3nSFE
- Sequence length
- 219 AA
- Molecular weight
- 24708,52480 Da
- Isoelectric point
- 5,64982
- Sequence
-
MQKLLMPFKKQMMLCGYKNPEYKKNWGYHHYGADISTIQGDAGKDHIIYASGEGIVAAVGRDNSLGWGIAVIYRDCLNHKTGEIYDLTARYMHMSECYVAQGQRVSAATPLALEGKEGTGDYHLHIEFDTDVDAPLFSPQVSKGHSFWKKGTDSTVDPSFVLHTATERVIVEPTYNPEWLNRDDFIIPFAENVDTEDYKALYHAARNKLEKISEIINNG
Other Proteins in cluster: phalp2_2134
| Total (incl. this protein): 102 | Avg length: 214,6 | Avg pI: 7,53 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3nSFE | 219 | 5,64982 |
| 11BHv | 215 | 5,93384 |
| 11BwG | 205 | 6,64388 |
| 11C1r | 210 | 5,94226 |
| 13u3o | 228 | 5,90332 |
| 1FYhv | 232 | 5,97693 |
| 1JfrM | 243 | 7,05124 |
| 1c43A | 218 | 9,96773 |
| 1caSD | 226 | 6,10385 |
| 1d7tN | 191 | 8,57534 |
| 1d8JE | 197 | 8,51552 |
| 1damN | 216 | 9,22512 |
| 1dau0 | 203 | 8,79370 |
| 1do8d | 203 | 8,79370 |
| 1drSh | 203 | 8,54272 |
| 1gO0m | 226 | 9,30100 |
| 1qBmo | 257 | 5,55763 |
| 2WEqT | 237 | 6,23702 |
| 2c5Ft | 261 | 9,07001 |
| 2l4ak | 191 | 9,12287 |
| 2lDBp | 246 | 6,29903 |
| 3nYBG | 253 | 8,70460 |
| 3o8VL | 226 | 9,52051 |
| 3wtSl | 225 | 5,35528 |
| 41bGy | 249 | 6,44193 |
| 4UeUs | 243 | 5,99784 |
| 4yaDn | 220 | 4,77950 |
| 5LaRq | 190 | 9,02108 |
| 5NL2Z | 191 | 9,02694 |
| 5OO2u | 186 | 9,15930 |
| 5TMc1 | 195 | 8,55265 |
| 5TNgX | 222 | 8,99207 |
| 5U9CO | 190 | 8,84811 |
| 5XLn8 | 203 | 9,26245 |
| 5Y0Ap | 191 | 9,02694 |
| 5ZXRn | 191 | 9,12287 |
| 5Zpcn | 206 | 4,93103 |
| 63YZn | 190 | 8,86016 |
| 64bUV | 183 | 8,72169 |
| 64s3e | 232 | 6,52258 |
| 65a6d | 190 | 8,87261 |
| 66D0h | 191 | 8,86326 |
| 67E4a | 188 | 8,63949 |
| 67UqI | 232 | 7,68306 |
| 6aC8y | 186 | 8,84289 |
| 6asY1 | 213 | 7,08500 |
| 6b0tB | 186 | 8,52119 |
| 6dy8A | 232 | 6,90312 |
| 6dzdw | 243 | 5,21261 |
| 6gsvu | 194 | 9,32943 |
| 6hivp | 190 | 8,84811 |
| 6pWaS | 243 | 5,09808 |
| 6smrd | 221 | 6,29324 |
| 6wvkP | 191 | 8,49128 |
| 7KzJC | 242 | 5,38307 |
| 7Vxnm | 236 | 6,65229 |
| 7XCYI | 249 | 4,82099 |
| 7Y9Td | 196 | 8,70963 |
| 7Y9ba | 199 | 8,92740 |
| 7YxNa | 216 | 5,39995 |
| 7Z8FM | 197 | 8,48096 |
| 7hHI3 | 245 | 5,41019 |
| 7hHK4 | 245 | 5,66579 |
| 7oqWA | 194 | 9,22531 |
| 7vV66 | 214 | 9,82487 |
| 7xSDd | 194 | 8,88524 |
| 82q0w | 199 | 9,03455 |
| 83LrF | 243 | 5,11843 |
| 83VIE | 197 | 8,47651 |
| 83uTL | 249 | 5,27656 |
| 84I6n | 235 | 6,36747 |
| 85XP3 | 250 | 7,54193 |
| 85mZ0 | 191 | 9,12287 |
| 87PmW | 225 | 5,46822 |
| 88B5O | 200 | 6,69759 |
| 890Y4 | 191 | 9,13615 |
| 89xB4 | 222 | 8,09641 |
| 8Ke8X | 210 | 9,43406 |
| 8bIk0 | 227 | 6,09447 |
| 8diHd | 264 | 5,42280 |
| 8eX4v | 250 | 5,39296 |
| 8eyvH | 191 | 7,65669 |
| 8jGsB | 193 | 8,75237 |
| 8kSfE | 191 | 7,63066 |
| 8lFsy | 198 | 8,62505 |
| 8lWYY | 167 | 6,63274 |
| 8mQLw | 221 | 6,58442 |
| 8oo44 | 186 | 8,48038 |
| 8ooEW | 195 | 8,90922 |
| 8ophx | 191 | 9,13615 |
| 8qDcg | 245 | 5,55416 |
| 8rqhn | 249 | 5,15208 |
| 8tJ3i | 195 | 6,27402 |
| 8vReq | 243 | 5,48146 |
| DNQx | 195 | 7,04323 |
| b4J5 | 204 | 8,84173 |
| nmPD | 250 | 6,29596 |
| nze7 | 286 | 8,96112 |
| o5kF | 235 | 7,68818 |
| o9My | 189 | 6,40953 |
| pZQb | 191 | 9,22551 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_7215
3nMMp
|
1 | 26,5% | 207 | 4.553E-49 |
| 2 |
phalp2_13280
3inuw
|
7 | 21,1% | 180 | 3.420E-16 |
| 3 |
phalp2_40658
5cY9d
|
663 | 22,7% | 158 | 2.067E-13 |
| 4 |
phalp2_21326
1KVjU
|
4 | 25,2% | 178 | 3.794E-13 |
| 5 |
phalp2_24391
4eTR4
|
9 | 20,8% | 197 | 2.940E-06 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3nSFE)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50