Protein
- Protein accession
- 6d2eY [EnVhog]
- Representative
- 7ZVMu
- Source
- EnVhog (cluster: phalp2_15505)
- Protein name
- 6d2eY
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MKRKVLFILLISIVFGFATGYSLHHLIHFNEKQDEMVMLPEHPFYLLEEVNEEVLYNTLVHYDFPSPAIITAQAVLESGNFKSKLCKDKNNLFGLYNSRTMSYFSFDSWISCVFAYKKFILNKYNPEENYYVFLDRIGYAEDSLYESKVKKLELEISNKYGNSE
- Physico‐chemical
properties -
protein length: 164 AA molecular weight: 19321,9 Da isoelectric point: 5,75 hydropathy: -0,18
Representative Protein Details
- Accession
- 7ZVMu
- Protein name
- 7ZVMu
- Sequence length
- 145 AA
- Molecular weight
- 17590,09350 Da
- Isoelectric point
- 7,74206
- Sequence
-
MKYLKLILPILIICSGFTNLSEVKVEKNIETKVSIKSLPFTLENLDYVLQEYNVLHRDIVIKQYILETGWGKSYNFRERNNLFGLYNSRKHQYFEFDHWTESVIAYRDLVQFKFEDGDYYKFLKDLPYAMDKNYIKKLKQIEYDI
Other Proteins in cluster: phalp2_15505
| Total (incl. this protein): 112 | Avg length: 159,2 | Avg pI: 6,84 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7ZVMu | 145 | 7,74206 |
| 1364J | 164 | 6,96172 |
| 1FSoX | 162 | 6,80990 |
| 1J7Z6 | 158 | 5,50926 |
| 1JaOY | 149 | 6,09174 |
| 1KvLc | 148 | 8,54214 |
| 1M4k8 | 148 | 8,75592 |
| 1XLQc | 148 | 7,72632 |
| 1Xekt | 157 | 9,57815 |
| 1XovC | 148 | 8,79247 |
| 1gOeb | 171 | 5,04687 |
| 35sPF | 156 | 9,57673 |
| 3KLUo | 168 | 6,96291 |
| 3QoD2 | 146 | 6,82377 |
| 3Zq92 | 180 | 7,60883 |
| 3aWT7 | 183 | 9,69490 |
| 3j1oy | 139 | 6,83167 |
| 3kPnh | 164 | 5,72240 |
| 3uBAw | 157 | 8,35692 |
| 4UUBA | 151 | 6,36525 |
| 4VMBu | 157 | 8,35692 |
| 4eToz | 158 | 6,73840 |
| 4fhP6 | 161 | 9,55185 |
| 4gG1D | 168 | 8,48547 |
| 4iDwN | 155 | 9,05292 |
| 4k2LS | 132 | 9,59220 |
| 4kqEF | 139 | 6,50292 |
| 4y8hZ | 165 | 7,00873 |
| 4yf59 | 168 | 5,70518 |
| 4yj2V | 165 | 9,16587 |
| 5KiQq | 165 | 5,55126 |
| 5KvFr | 165 | 5,96147 |
| 5NqWz | 165 | 5,55126 |
| 5Nqve | 157 | 8,35692 |
| 5NvHF | 165 | 5,55126 |
| 5OAqB | 165 | 5,34834 |
| 5OBVv | 165 | 5,24291 |
| 5ODQr | 157 | 8,35692 |
| 5ONKT | 163 | 5,92134 |
| 5Q1zu | 165 | 6,51604 |
| 5QVXQ | 181 | 8,78280 |
| 5TGlu | 163 | 5,19738 |
| 5VgMC | 157 | 8,34590 |
| 5VqoJ | 144 | 5,80573 |
| 5Xhee | 165 | 5,96840 |
| 5Xlw6 | 165 | 5,55126 |
| 5Xtvq | 165 | 5,95055 |
| 5Y8S0 | 157 | 6,90323 |
| 5ju25 | 158 | 5,70842 |
| 618g2 | 144 | 5,56393 |
| 61ySL | 181 | 8,72904 |
| 62IIQ | 157 | 8,35692 |
| 63SDe | 165 | 5,55126 |
| 64Ev0 | 135 | 6,05548 |
| 65cwE | 165 | 5,72240 |
| 65wav | 157 | 7,70910 |
| 66uZ4 | 148 | 6,05275 |
| 672Sy | 165 | 5,41121 |
| 67Gz7 | 157 | 6,90323 |
| 68oBG | 164 | 5,75315 |
| 6aIR9 | 198 | 5,42883 |
| 6bu4w | 144 | 5,06546 |
| 6c74l | 163 | 5,19738 |
| 6fHzT | 157 | 8,35692 |
| 6guEi | 157 | 8,67147 |
| 6hD42 | 164 | 5,37585 |
| 6iPJg | 144 | 5,56393 |
| 6isbh | 164 | 5,57059 |
| 6lTRn | 157 | 8,35692 |
| 6latE | 163 | 5,19738 |
| 6mHf5 | 121 | 5,88917 |
| 6nKRi | 121 | 6,06253 |
| 6nvA9 | 166 | 5,74889 |
| 6nzQC | 157 | 7,69989 |
| 6oNe1 | 198 | 5,42883 |
| 6ogGA | 162 | 6,30210 |
| 6pjGf | 165 | 5,55126 |
| 6prmk | 163 | 5,19738 |
| 6qDAY | 144 | 5,19903 |
| 6qGiK | 165 | 5,55126 |
| 6r4kS | 144 | 5,36295 |
| 6rWU6 | 163 | 5,19738 |
| 6sB4T | 185 | 5,24348 |
| 6sfzX | 162 | 7,61940 |
| 6uhWe | 157 | 8,35692 |
| 6uywH | 165 | 5,55126 |
| 6v1d9 | 165 | 5,55126 |
| 6vHCt | 163 | 5,19738 |
| 7ABtR | 162 | 7,61611 |
| 7APkH | 156 | 6,90022 |
| 7JD15 | 160 | 8,90581 |
| 81NqZ | 157 | 8,34590 |
| 81ivH | 157 | 8,61718 |
| 84PHs | 160 | 5,04329 |
| 84Uc3 | 153 | 5,62231 |
| 850bq | 164 | 7,74252 |
| 8DXmL | 149 | 9,14324 |
| 8LDaX | 157 | 8,81400 |
| 8fEdl | 163 | 5,57059 |
| 8loCw | 165 | 5,60793 |
| 8lotN | 156 | 5,89701 |
| 8m1yQ | 164 | 5,10047 |
| 8m4Pn | 151 | 5,91094 |
| 8nS7Q | 174 | 6,64945 |
| 8sdIP | 156 | 5,81221 |
| DfOM | 189 | 8,73090 |
| En1N | 148 | 8,88892 |
| LB5j | 150 | 9,22228 |
| OnF5 | 157 | 6,83139 |
| s8w | 149 | 7,78831 |
| sBYw | 156 | 9,55268 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1651
8ptVD
|
196 | 56,3% | 110 | 7.241E-47 |
| 2 |
phalp2_2868
lM6F
|
24 | 42,3% | 137 | 3.763E-40 |
| 3 |
phalp2_38265
eDdp
|
15 | 46,6% | 103 | 8.032E-38 |
| 4 |
phalp2_24545
7HQNr
|
274 | 35,8% | 120 | 8.541E-32 |
| 5 |
phalp2_35464
jtBB
|
94 | 41,2% | 109 | 7.961E-28 |
| 6 |
phalp2_32846
31z3H
|
398 | 32,3% | 139 | 2.807E-27 |
| 7 |
phalp2_33922
20wTw
|
220 | 30,8% | 136 | 6.549E-26 |
| 8 |
phalp2_28440
1Kzbw
|
6 | 35,2% | 119 | 3.552E-23 |
| 9 |
phalp2_40200
2dngU
|
73 | 35,7% | 137 | 1.549E-21 |
| 10 |
phalp2_14488
4MvhY
|
9 | 31,2% | 112 | 2.905E-21 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7ZVMu)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50