Protein

Protein accession
6cwm0 [EnVhog]
Representative
3Q2DF
Source
EnVhog (cluster: phalp2_25577)
Protein name
6cwm0
Lysin probability
99%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
MTENEARKKVVSIAKQYIGCKESDGSHKKIIDGYNAVKPLPKGYKVGYKDSWCATFVSFVGIKAGFSDIIQRECGCERMIALYKKLGRWVENDAYTPQIGDVIFYDWDDSGKGDDTGFSDHVGIVVSVNGNTLKVIEGNKNDAVGYRNIKVNGKYIRGYGIPDYASKSDSSVVVDEKAVDSDIKVDSAKSFSKSLAGTYKTTTDLNMRTGAGTSKSVITVIPKNKNVTCYGYYTYFNGAKWCYVIYKDSNGIKYNGFVSGNYLKK
Physico‐chemical
properties
protein length:265 AA
molecular weight:29287,8 Da
isoelectric point:9,09
hydropathy:-0,44
Representative Protein Details
Accession
3Q2DF
Protein name
3Q2DF
Sequence length
249 AA
Molecular weight
26993,40500 Da
Isoelectric point
8,80588
Sequence
MNEKQLRDKLVKKAVSYLGTKAGSARHKNIVDTYNKIVPLPAGYKVKYTDPWCATFVSFCASVCDMLDIIPAECGCSRQIELWQKLGRWQERDSYVPQTGDIIYFDWDDSGKGDNTGWSDHVGIVVSVSGGKIKTIEGNKSNAVGYRTIAVDGKYIRGYGLPDFASKSTEDTKMDTCNVELNVLAKGCKGDSVKALQILLKGYGYSIGSSGVDGSFGPSTLSAVKKYQKDKGLSVDGSVGPATWKSLLG
Other Proteins in cluster: phalp2_25577
Total (incl. this protein): 166 Avg length: 265,8 Avg pI: 7,81

Protein ID Length (AA) pI
3Q2DF 249 8,80588
13a3X 308 9,61760
13qpp 246 6,82826
13yll 277 8,95990
13ysn 301 9,02727
19brJ 251 7,49555
1FYHy 267 4,77461
1IQ1e 234 4,91779
1NysY 235 6,37855
1ctjZ 268 9,49498
1dR15 283 9,23247
1gAfP 286 9,31776
1gDzZ 252 5,52551
1gE4H 256 9,39422
1gG92 318 9,07439
1gHA2 243 8,88640
1jBnA 246 6,33507
1jLno 344 8,74470
1kbIS 246 6,82417
1kf2b 283 9,12519
21l9p 264 8,70860
21n8x 276 4,54277
21rFh 262 5,05619
235xu 264 5,25666
23dUA 224 9,05860
23gNn 262 9,08007
23hZm 196 5,32061
23qpX 292 9,58008
23t3I 274 5,99551
24Em4 255 6,83423
24GM1 314 9,08729
24mbt 320 9,44599
24mhP 266 4,97775
24p34 262 9,15711
24qTa 298 6,13124
2Vikb 226 9,17696
2Vmte 267 9,20713
2bMvl 348 8,35157
2oee3 325 9,48647
2pfPS 283 9,00464
38ICa 218 9,24369
3ArdV 275 9,58692
3PNjR 246 8,57180
3Q2ll 312 9,27334
3TDIr 309 4,96411
3TKEc 310 4,65599
3TKVB 261 8,53969
3TQVm 309 4,90426
3WIrZ 223 9,20810
3WIu1 225 5,96857
3WLU9 295 5,90207
3WN2f 264 8,78261
3WOYv 309 4,80076
3ZT3r 298 9,57873
3Zy9F 234 5,56189
3caQE 268 9,54037
3gk9M 294 9,64500
3h7HN 261 5,95965
3kvij 271 9,01276
3nMFp 256 8,39051
3nQqg 264 9,44812
3nRkY 220 9,73216
3nUAN 243 9,45450
3nUPN 287 9,10431
3nV0k 278 6,12675
3nzFd 270 8,78422
3o5zC 288 9,16574
3qPgQ 271 8,90800
3vZJ3 194 7,84272
3vfvj 270 9,23750
3vhmL 246 8,94223
3weLs 264 9,29881
3yjjM 292 5,31987
400n1 262 8,58482
40XZ6 266 5,50937
41ciI 174 4,83549
41dGU 281 4,67452
45jpJ 270 9,43838
45xbE 288 9,11269
4JZFw 294 7,58956
4Mk73 268 8,75714
4Odz8 270 8,88234
4SOjR 275 9,67917
4yli1 308 9,61315
5C0PM 319 8,79247
5Mtxl 253 8,10421
5NYmB 263 9,43006
5NrUs 214 6,56953
5Py1p 263 5,74764
5SZVG 233 6,95507
5T505 262 5,88490
5TTD0 314 9,19953
5UOW8 233 7,65209
5UgEm 322 9,34078
5WSoQ 301 8,95042
5XHZx 263 5,72229
5XjxZ 234 6,95507
5XrpX 284 7,57655
60VK3 263 5,53739
62hmm 221 8,94410
63BC9 218 9,39925
65NuF 314 9,47487
65iCp 322 9,30029
66N12 216 9,00025
66qnn 269 5,75020
671J4 272 8,76443
6a03o 263 5,37921
6bAVO 233 7,64879
6bF3o 271 8,97866
6eLJk 312 6,22872
6eV3X 263 9,45624
6fHEm 246 6,33524
6h7PQ 253 9,62947
6iIUQ 271 9,06878
6k9fs 284 9,16342
6lCVz 269 9,24452
6nYYC 263 5,99779
6nrIF 233 7,65209
6o59l 217 6,14182
6p4gq 257 9,27966
6pecU 263 5,67176
6qOuG 260 9,28817
6qQMD 218 5,21062
6qd9K 248 9,11655
6rcig 263 6,00080
6svYr 239 4,60222
6ug7q 275 9,29242
6usJV 271 8,88357
6wGka 263 9,40950
75e2 314 9,13925
7JyGw 215 8,42049
7QI8J 258 5,07222
7gTgX 259 9,84434
7q0Rr 275 4,62638
7q2Jl 217 9,42471
81TqF 187 9,33149
83wUi 255 9,67620
84McK 249 5,73616
84xcR 275 9,24452
85CDv 258 5,17334
86kfd 225 6,14261
88cUg 275 9,46488
8brhK 253 5,82716
8ca8z 242 5,02539
8ccR4 292 5,29190
8cmYI 263 5,53739
8cwUA 258 5,29116
8fc3i 314 9,19927
8ffiI 258 5,07404
8ie7m 263 8,03529
8n7aI 214 9,20623
8rJjx 272 9,09644
8s68H 263 5,74099
9ama 244 6,10970
DBhS 258 5,07404
a3ke 272 8,76353
b5aq 300 9,12178
cadv 225 6,12852
obUd 255 9,24001
ofp0 314 9,20152
ojbf 312 9,38333
pos6 271 9,01270
xslF 270 9,20488
z2MM 271 9,09683
z7Y0 269 9,24452
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_15661
2WFec
420 61,7% 175 3.389E-96
2 phalp2_30942
13AWP
189 59,6% 166 6.717E-87
3 phalp2_7368
4xoTh
314 53,2% 197 8.331E-86
4 phalp2_21388
3uuxO
25 40,6% 261 3.739E-78
5 phalp2_27238
3TMvJ
21 46,0% 252 9.607E-78
6 phalp2_35905
7DH9G
6 45,2% 188 1.646E-73
7 phalp2_32863
38KGa
2 51,3% 181 2.052E-69
8 phalp2_14320
3VFlX
143 35,1% 273 8.950E-62
9 phalp2_36036
5N9T1
7 34,5% 237 1.850E-56
10 phalp2_31113
21AWU
59 30,0% 276 1.492E-54

Domains

Domains
Representative sequence (used for alignment): 3Q2DF (249 AA)
Member sequence: 6cwm0 (265 AA)
1 249 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01471, PF05257

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3Q2DF) rather than this protein.
PDB ID
3Q2DF
Method AlphaFoldv2
Resolution 94.37
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50