Protein
- Protein accession
- 6aDCr [EnVhog]
- Representative
- aOy2
- Source
- EnVhog (cluster: phalp2_15097)
- Protein name
- 6aDCr
- Lysin probability
- 53%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
VWCVLTRFDDPRFPDTVLEVIEAPYQFSGYDPEYPVKEEFALLAADVLTRYRAERDGEENVGRVLPAEYCFFTGDGRRNHFTTEWKSTDCFGWTLESPYTD
- Physico‐chemical
properties -
protein length: 101 AA molecular weight: 11815,9 Da isoelectric point: 4,41 hydropathy: -0,54
Representative Protein Details
- Accession
- aOy2
- Protein name
- aOy2
- Sequence length
- 108 AA
- Molecular weight
- 12714,95450 Da
- Isoelectric point
- 4,80872
- Sequence
-
DKAEQAAVAWCILNRVDTEGFPDTITAVIQQPYQFAWSAKTPIKDELRELAADVYDRWQFEKTGETEVGRVLPNTYLFFHGDGKHNYFRETYRGKVYWDWTLESPYDV
Other Proteins in cluster: phalp2_15097
| Total (incl. this protein): 63 | Avg length: 139,3 | Avg pI: 4,62 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| aOy2 | 108 | 4,80872 |
| 1G1Mc | 205 | 4,18121 |
| 1mh39 | 176 | 4,32342 |
| 2c7BP | 205 | 4,18678 |
| 367kN | 186 | 5,45253 |
| 3icpc | 170 | 5,29293 |
| 3kSfp | 176 | 4,32342 |
| 3nJeQ | 89 | 4,05003 |
| 3o8bL | 167 | 5,01766 |
| 3oqAk | 176 | 4,32342 |
| 3pC1C | 76 | 4,52992 |
| 3pyBs | 112 | 4,66019 |
| 3qEBc | 172 | 4,35076 |
| 3sG7O | 147 | 7,98314 |
| 3vHmN | 102 | 4,72329 |
| 3w6ha | 207 | 4,80042 |
| 4Me9r | 126 | 4,51503 |
| 4Ue6i | 144 | 4,21429 |
| 4UhL2 | 77 | 4,42113 |
| 5KP2O | 123 | 4,50309 |
| 5N2gA | 156 | 4,26641 |
| 5O3nt | 160 | 4,48655 |
| 5OEYo | 85 | 4,45063 |
| 5OMoB | 161 | 4,32348 |
| 5OPMN | 78 | 4,66065 |
| 5Q1gQ | 145 | 4,34656 |
| 5QPf0 | 99 | 4,45495 |
| 5S7e3 | 85 | 4,42039 |
| 5SHka | 123 | 4,70982 |
| 5TIpy | 117 | 4,49570 |
| 5TrRx | 160 | 5,41007 |
| 5VnY1 | 161 | 4,38731 |
| 5jA52 | 101 | 4,05003 |
| 60F4M | 210 | 4,67889 |
| 61WFi | 176 | 4,34423 |
| 62aS7 | 83 | 4,55982 |
| 65mxv | 166 | 4,50218 |
| 6HR8N | 202 | 4,52310 |
| 6aNaL | 161 | 4,48752 |
| 6gheE | 80 | 4,44909 |
| 6ib3w | 161 | 4,28085 |
| 6l1zI | 96 | 4,55965 |
| 6lo21 | 84 | 4,21657 |
| 6nHEL | 93 | 4,20719 |
| 6r7c4 | 183 | 5,39916 |
| 6rIbj | 97 | 4,41130 |
| 6tgKu | 135 | 4,85834 |
| 6uf4L | 110 | 4,29046 |
| 7Vp5m | 83 | 4,31626 |
| 7Y8jM | 99 | 4,58449 |
| 7xyoJ | 121 | 5,11428 |
| 7xyoK | 121 | 5,11428 |
| 85j1S | 163 | 4,76682 |
| 87JV3 | 161 | 4,41891 |
| 8ePLL | 221 | 5,02243 |
| 8lxJ8 | 141 | 4,66264 |
| 8mRKr | 149 | 4,49650 |
| 8sHdp | 210 | 4,80224 |
| 8vPmk | 160 | 4,92978 |
| OwPw | 151 | 4,54379 |
| gpYa | 96 | 4,28864 |
| nuKN | 185 | 4,39231 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_16676
ovpD
|
20 | 40,8% | 93 | 1.542E-31 |
| 2 |
phalp2_10953
4JVN9
|
1 | 34,0% | 100 | 7.625E-24 |
| 3 |
phalp2_12981
3imOy
|
1 | 28,9% | 114 | 2.741E-16 |
| 4 |
phalp2_21496
8r8pU
|
1 | 36,0% | 75 | 2.507E-15 |
| 5 |
phalp2_15713
3fK4E
|
1 | 31,9% | 72 | 3.940E-13 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(aOy2)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50