Protein

Protein accession
6YxhZ [EnVhog]
Representative
5KMWz
Source
EnVhog (cluster: phalp2_24673)
Protein name
6YxhZ
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MLKIKGIDISRAQEQFDFTAAASAGVKFVIIRAGICTDEDTYFRRNIEQCRKLGIDFGCYWYVTATDREELDRQINACIKTIGDEKPSYPVFCDMEEQRQIDNLTSKERTDMALEFCDRLNKAGLPSGVYANPAWLESYYQKERIVGKRDIWLAHWTESPDYASRYDYGQKMWQWGIDSIAGKDVDGDICFVDYPAITAKWYKENCGDMPEKPEKPEKPEKPVNLFKKGDSVRVKRGARFTNGVEPYSYVYDTIYTVQQVSASGKETLIGIGSVPT
Physico‐chemical
properties
protein length:276 AA
molecular weight:31589,3 Da
isoelectric point:5,24
hydropathy:-0,58
Representative Protein Details
Accession
5KMWz
Protein name
5KMWz
Sequence length
357 AA
Molecular weight
40053,09340 Da
Isoelectric point
8,83992
Sequence
MQIKAIDISYSNVITDYGKVRAAGVRAAIIRNGYLGKTDDLYHTHMKGAIKAGLEVGTYTYIVSRSVQQARTEARETLERLKPYRGHLTYPVFCDIEDERYLNGEWGSFTRRQFTDIIKTFCEEIEKGGYYPALYINPAWLESYTYKAELIGKYDIWLAAWTGNPNIPTKYNYGQVMWQWGKGAVSGVKEQVDGDLIYIDYPAKIRAAGKNYLHQKPIKTEYVHDVYTSLGRAAIRCSCHRDGDDNIITRCEKGRLYPVDAVITVGGAKWISHAGMVGYSMLQDGGKLFDKTGAYELLRTTAELNVRSSPQVAKGNELGRLKKGAEVYCVGEASGGWKEILYNDGTAFVSGAYVKKV
Other Proteins in cluster: phalp2_24673
Total (incl. this protein): 154 Avg length: 336,3 Avg pI: 6,36

Protein ID Length (AA) pI
5KMWz 357 8,83992
13Bn2 355 5,22876
13cuA 306 5,61770
13tcK 352 5,00117
1GctF 352 5,49033
1miHh 349 5,19801
1miVr 367 6,83599
1ndpB 355 5,30537
1ob1e 351 5,29816
2E2p 288 5,89752
2GLz 289 6,65735
2GSP 349 5,38751
2HQs 352 4,91830
2lsHg 352 5,21784
2m1ya 357 5,13008
2mam5 284 8,56780
2mzPo 289 8,31347
2y4N 355 5,12389
2z7I 349 5,29952
2z9P 289 5,91662
3B4bv 289 6,66241
3KSXD 288 6,64382
3k1IZ 350 5,40695
3k1ON 288 6,23861
3kJOr 365 5,95988
3kT3K 349 5,29952
3kfDB 311 6,15648
3kyVe 349 5,11758
3ldYd 289 8,78093
3miC8 355 5,08211
3mo1s 357 5,59707
3nvzg 356 5,14304
3p1ax 366 5,94925
3rlmb 289 5,66710
3sdZI 355 5,20414
3se5j 289 8,49953
3semv 289 6,08401
3sklf 349 5,17538
3t3S4 361 6,10305
3t8Ip 360 5,04806
3t99A 365 5,80965
3tHBs 358 5,14532
3tTQi 365 7,00071
3tXNP 352 5,12542
3tfdD 352 4,95502
3tm7p 288 8,07339
3tmnK 355 5,43014
3ttSs 355 5,36687
3tutA 355 5,21784
3u3Kq 366 5,24410
3u577 289 6,05053
3u5tE 366 5,91151
3u66Y 289 8,30889
3uBi7 368 5,43588
3uRYt 367 5,84557
3uX21 352 5,06227
3umnW 289 8,63768
3unCs 289 8,51004
3v4cv 355 5,06989
3vB8H 288 6,64314
3vBTa 355 5,06364
3vBqh 353 5,11690
3vCLU 349 5,11758
3vDGW 289 8,64839
3vt8R 358 5,24410
3vwfw 355 5,12389
3w7aY 361 5,60884
3w84K 289 7,49163
3w85n 244 8,80872
3wPgX 349 5,11758
3wRV8 352 5,04153
3xyTU 352 5,00117
3y4rh 368 5,57900
3yAbw 349 5,19801
3yE7J 365 8,01801
3yEJl 354 5,05540
3yVF1 311 5,74809
3yd14 364 6,90431
3yf1u 289 5,81670
3yjoC 361 5,01504
3ymRt 355 5,21960
3zE9N 295 8,76359
4VDgx 357 5,23018
4VTXu 363 4,96843
4VU3O 365 8,48096
4VUc7 367 5,91151
4VUcd 289 6,23873
4VyA7 307 8,60493
4z1Zf 335 5,04102
4z1uU 289 8,63253
4z6BF 358 5,54552
5KCU0 290 8,73239
5NXH8 369 5,73894
5NtDB 356 5,30975
5RT7i 355 5,07603
5S1NI 363 8,90665
5SuWB 363 9,03777
5TQ6K 284 5,34431
5VVcL 304 8,60493
5WErD 367 5,38501
64YXi 363 9,20159
66w4Q 350 5,13861
6709q 359 5,13702
680hT 350 5,04755
68jIK 319 8,87145
6YqP7 290 8,31347
6Yz6Y 366 8,46691
6ZbdU 289 6,23861
6ath2 363 8,89536
6duPS 365 8,29665
6fshE 366 6,47455
6jwai 351 5,02863
6kG4N 363 8,81961
6mWu3 366 6,47467
6np4y 358 6,10294
6pd65 366 6,15074
6qx2q 366 6,46210
6s2l4 363 9,01766
6ssaF 366 6,89971
6uHq2 340 7,49589
6vqB4 369 5,83750
6wNT8 356 5,07688
6wbYy 269 5,22785
6wqS4 366 5,71234
7BmW6 350 5,56831
7MPi5 365 8,49005
7Undp 358 5,14458
7W0rc 288 6,64888
7qZUo 299 5,17715
85aR6 349 5,00742
85f2S 289 8,31805
86NZ2 349 5,19533
89Xvl 355 5,15049
8cwmi 365 6,08515
8gisk 289 8,06881
8kXjD 354 5,13707
8lgSA 340 8,47090
8m9xe 308 7,72541
8rywf 355 5,15049
8sw8L 352 5,21096
8sxa1 290 8,04722
A0w5 363 9,09051
Cnvf 289 6,23861
EF5N 290 5,66710
EJN1 364 7,54665
EJvV 290 5,91662
EYaq 361 5,45338
KInR 245 8,96602
NvoK 313 9,09670
ONMs 297 5,90036
ql8h 391 8,06495
wQ9C 363 9,01766
z9ug 355 5,05591
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_33958
3uV8Y
5 34,2% 222 6.565E-101
2 phalp2_35683
3zpKE
30 32,9% 243 1.943E-53
3 phalp2_24363
400dW
200 35,2% 227 3.382E-48
4 phalp2_10747
3nEcV
19 32,7% 244 8.541E-48
5 phalp2_34771
3k1Sy
11 28,0% 260 4.718E-46
6 phalp2_19565
3TIJJ
398 27,1% 258 5.555E-45
7 phalp2_30323
4yw07
4 29,8% 298 1.029E-44
8 phalp2_15044
7hFHn
33 32,5% 224 6.527E-44
9 phalp2_15489
81O6h
75 29,7% 232 7.651E-43
10 phalp2_19012
13yc5
26 30,4% 250 1.418E-40

Domains

Domains
Representative sequence (used for alignment): 5KMWz (357 AA)
Member sequence: 6YxhZ (276 AA)
1 357 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01183, PF08239

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5KMWz) rather than this protein.
PDB ID
5KMWz
Method AlphaFoldv2
Resolution 83.89
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50