Protein
- Protein accession
- 6ST7x [EnVhog]
- Representative
- 5nMaO
- Source
- EnVhog (cluster: phalp2_27545)
- Protein name
- 6ST7x
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 91% (predicted by ML model) - Protein sequence
-
MRGEDVKLMQGALKRKGYYKGETDGVWGILSSQAAQRAKYWLGYRKPDKVAGDLLLAYLQDRKNPTKVMAFYRARRLRLKAKVPMRVKALNAAIARIGETENPPNSNRSPASLWYGLIGAWCAMSVTRSYVTAGSKAWIRGKFYAYCPFIYHDAMGGRNNLTITTHPQPGDVVLYDWGNPDRLARHVGLFEGWLPGSQDRFTAIEGNTGVGNDSNGGKQMRRGEGNDIRSMSMVLAFVHVGG
- Physico‐chemical
properties -
protein length: 242 AA molecular weight: 26920,6 Da isoelectric point: 10,03 hydropathy: -0,46
Representative Protein Details
- Accession
- 5nMaO
- Protein name
- 5nMaO
- Sequence length
- 242 AA
- Molecular weight
- 26745,87490 Da
- Isoelectric point
- 9,95961
- Sequence
-
MRGQDVKDAQSRLQGTNVFKQNFQPGKVDGIFGEGTARACKRAKYWCGYEQAKCLASYGNQLNGFLSGKVKLPPAYASRRKKRLTAAKAKPLRQKALDRAKTQIGTKESPRGSNRQKYGAWYGLNGAPWCAMFVTWCYVSEGSRALARGRRFAYVPWVVGEARAGRNHLAITRNPQPGDLVCFDWNHDGTSDHVGLYEKDLPGGDFQAIEGNTGEGNDSNGGEVMRRRRNVSQVQAFVHVGG
Other Proteins in cluster: phalp2_27545
| Total (incl. this protein): 117 | Avg length: 246,2 | Avg pI: 9,49 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5nMaO | 242 | 9,95961 |
| 15MNP | 240 | 10,01067 |
| 15gXk | 235 | 9,74293 |
| 167XZ | 255 | 9,02920 |
| 16JlI | 211 | 8,43957 |
| 16Mqs | 252 | 10,09796 |
| 16NKT | 224 | 10,03175 |
| 16cw5 | 244 | 9,94104 |
| 18n40 | 245 | 9,56777 |
| 1CYgR | 238 | 10,34803 |
| 1ItjM | 277 | 7,11626 |
| 1NEab | 253 | 9,95490 |
| 1NGe6 | 253 | 9,95490 |
| 1O0qT | 247 | 9,58460 |
| 1Zb7k | 239 | 9,56609 |
| 1ZcUA | 246 | 9,31995 |
| 1cD4O | 248 | 9,29945 |
| 1fYJq | 236 | 9,26142 |
| 1gvh2 | 245 | 9,56828 |
| 1gvyW | 252 | 10,20485 |
| 1iNay | 245 | 9,51123 |
| 1nI70 | 254 | 9,80650 |
| 1p77s | 250 | 9,39731 |
| 1p79e | 239 | 9,58028 |
| 1prG5 | 268 | 10,79215 |
| 1qXZD | 253 | 9,95490 |
| 25hOK | 247 | 9,29952 |
| 25jY5 | 187 | 8,80904 |
| 2793e | 246 | 9,62959 |
| 285hs | 244 | 9,34703 |
| 2IrOT | 248 | 10,01131 |
| 2jdyk | 246 | 9,40931 |
| 31PDT | 247 | 9,62463 |
| 32dmn | 247 | 9,67221 |
| 3VUoG | 246 | 9,70399 |
| 3bpDN | 245 | 9,71650 |
| 44ubu | 245 | 9,76956 |
| 45UeM | 245 | 9,41317 |
| 46RQZ | 246 | 9,74061 |
| 47Cmw | 245 | 9,36418 |
| 48Hhf | 246 | 9,59265 |
| 4AfvX | 238 | 9,90745 |
| 4DhzX | 258 | 9,32859 |
| 4EHjp | 269 | 9,05363 |
| 4ENuu | 287 | 6,41311 |
| 4FfC2 | 244 | 10,61312 |
| 4HTzI | 290 | 9,19901 |
| 4IAhR | 256 | 9,54817 |
| 4IBnz | 258 | 9,02888 |
| 4Mvx5 | 260 | 5,68654 |
| 4aHGy | 245 | 9,63121 |
| 4cdIg | 262 | 9,46810 |
| 4ojjZ | 237 | 9,85362 |
| 4pHqD | 248 | 10,04251 |
| 4zWrc | 238 | 9,66886 |
| 53toH | 236 | 9,43052 |
| 54WY5 | 236 | 9,51600 |
| 57Szx | 236 | 9,67279 |
| 58pI4 | 234 | 9,59336 |
| 59zBS | 236 | 9,50027 |
| 5AZjB | 247 | 9,53386 |
| 5BqOW | 237 | 9,89611 |
| 5DAvj | 234 | 9,78490 |
| 5Dm0z | 263 | 9,31331 |
| 5F0aL | 255 | 9,84621 |
| 5Fqox | 254 | 9,18470 |
| 5GCaB | 237 | 9,09547 |
| 5GWiA | 259 | 8,82580 |
| 5H1Wa | 281 | 10,00422 |
| 5HCfi | 262 | 9,05447 |
| 5Hi4c | 235 | 9,70464 |
| 5K5D | 245 | 9,44154 |
| 5aFG2 | 245 | 9,62373 |
| 5b3Wj | 238 | 9,84427 |
| 5caXc | 235 | 9,23202 |
| 5ekpx | 234 | 9,40421 |
| 5gcB9 | 244 | 9,56616 |
| 5iTgO | 246 | 9,58956 |
| 5lY1o | 236 | 9,50059 |
| 5m3QX | 244 | 9,61109 |
| 5mTkd | 236 | 9,48544 |
| 5mo2h | 234 | 9,70393 |
| 5n65I | 236 | 9,50027 |
| 5nLdd | 248 | 10,00267 |
| 6Aj1V | 255 | 9,08516 |
| 6D7R4 | 263 | 9,36173 |
| 6DN46 | 237 | 10,00267 |
| 6GOYC | 257 | 9,51839 |
| 6HYRi | 264 | 9,20733 |
| 6HZux | 264 | 9,22415 |
| 6I1Oo | 234 | 6,95723 |
| 6KfNb | 229 | 9,89572 |
| 6KgmC | 258 | 9,37340 |
| 6Kz1P | 237 | 9,72436 |
| 6LsqN | 235 | 9,64358 |
| 6QA3A | 195 | 9,42749 |
| 6SIlH | 256 | 9,22886 |
| 6VfPr | 255 | 9,69580 |
| 6xVjP | 248 | 9,95297 |
| 7XKQW | 244 | 9,38700 |
| 83ckY | 244 | 9,72198 |
| 88qlK | 247 | 9,80321 |
| 88xcN | 246 | 9,72378 |
| 8pOUs | 255 | 9,37797 |
| CcxH | 235 | 9,47629 |
| CjuX | 231 | 9,33162 |
| FOqe | 245 | 9,61728 |
| Gw81 | 219 | 9,70483 |
| SAjE | 253 | 8,96073 |
| ZDwq | 223 | 8,29130 |
| gsaZ | 263 | 10,85417 |
| h1wj | 246 | 9,63952 |
| hiBF | 259 | 9,10959 |
| hk33 | 278 | 10,12652 |
| hkqg | 269 | 9,61502 |
| jGW7 | 247 | 10,20111 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13275
3f0gi
|
20 | 33,5% | 265 | 2.629E-56 |
| 2 |
phalp2_35989
5sZwz
|
4 | 34,9% | 246 | 2.365E-55 |
| 3 |
phalp2_32170
6Q07M
|
13 | 34,7% | 256 | 1.254E-52 |
| 4 |
phalp2_26320
19Heu
|
35 | 35,2% | 272 | 1.697E-49 |
| 5 |
phalp2_10911
4DZTv
|
37 | 31,3% | 258 | 2.041E-45 |
| 6 |
phalp2_7242
3OKiC
|
1 | 34,2% | 216 | 5.079E-42 |
| 7 |
phalp2_17977
1cKmn
|
23 | 43,3% | 159 | 4.903E-39 |
| 8 |
phalp2_33264
5Ekx7
|
97 | 36,5% | 156 | 1.251E-38 |
| 9 |
phalp2_27346
4wbgy
|
15 | 43,9% | 157 | 4.426E-33 |
| 10 |
phalp2_4061
1gHkc
|
4 | 36,8% | 160 | 1.425E-29 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5nMaO)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50