Protein
- Protein accession
- 15N69 [EnVhog]
- Representative
- 8jh1R
- Source
- EnVhog (cluster: phalp2_6842)
- Protein name
- 15N69
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MVAINRKVLDISHHNDVSSWSQVKGAGIVGIIHKATEGSSYTDPQYIPRCAPAMNTGLMWGAYHWINAGSIQPQVDNFLKVVGVDDETLYALDWEDDPNNGTASRDQAQEFLDRIGQEIGVYRCVVYSGNTAKEKLGSSSNEYFGKHRLWLAQYGTTPTPQASWDDYWLWQYSDGNVGPTPHGCPGVTGDVDTNSWPGTDGDLRQQWAGISDAPAPPVQTSHVDININITGDVIVTVNGKPI
- Physico‐chemical
properties -
protein length: 242 AA molecular weight: 26474,9 Da isoelectric point: 4,71 hydropathy: -0,46
Representative Protein Details
- Accession
- 8jh1R
- Protein name
- 8jh1R
- Sequence length
- 274 AA
- Molecular weight
- 30912,46990 Da
- Isoelectric point
- 9,00444
- Sequence
-
MIILGVDASKYQGLSGMSHQRFDSLDDAGVRFGIFRATIGTQRDRSCEENLKRAKGRGWVFGTYHFLVPGDTDAQAEAYAAQLKSFGVYGDGLAVCDVEQAGLTSTMVRRFVRRFRELRPDQPLGCYTSSYKWRSLTGNMDGADLFDYLWNALWTQRSTRGKEDLPDTPPRVRYGGWKEARLWQYGMFRAQGVRLDGNAFYGTIDELRDLGIKKAPPLKERPNYRKGYNAVIEKALGSVWTNPASNGPAYDLGEKDAADDLRERIKDLRIGEPV
Other Proteins in cluster: phalp2_6842
| Total (incl. this protein): 119 | Avg length: 248,4 | Avg pI: 5,18 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8jh1R | 274 | 9,00444 |
| 116bJ | 270 | 4,70294 |
| 11DLF | 271 | 4,67082 |
| 11DXy | 265 | 4,74659 |
| 11EAP | 240 | 5,78993 |
| 15Fut | 251 | 4,41454 |
| 15GSi | 287 | 4,63354 |
| 15HKi | 239 | 4,31189 |
| 15HW1 | 262 | 4,67662 |
| 15I06 | 234 | 4,48172 |
| 15I2S | 238 | 4,49093 |
| 15IAI | 259 | 4,41084 |
| 15MnI | 245 | 4,50798 |
| 16gHk | 265 | 4,74659 |
| 16gil | 232 | 4,23777 |
| 16hdv | 238 | 4,72124 |
| 16heM | 261 | 5,21062 |
| 16hyK | 243 | 4,65553 |
| 16itn | 246 | 4,19042 |
| 1IlCI | 298 | 5,88422 |
| 1IlnS | 288 | 6,09544 |
| 1NIWC | 256 | 4,60841 |
| 1ZdUj | 291 | 5,59997 |
| 1atIB | 324 | 5,72246 |
| 1cIfP | 237 | 7,81455 |
| 1dwHd | 238 | 4,46018 |
| 1fZ39 | 220 | 5,00396 |
| 1gw9L | 244 | 4,38544 |
| 1lSoG | 210 | 5,85177 |
| 1p5UV | 204 | 6,18024 |
| 1p6X4 | 253 | 4,30757 |
| 1pLas | 235 | 4,24209 |
| 1reGn | 293 | 5,17692 |
| 25lf7 | 264 | 4,33314 |
| 2Sas3 | 203 | 5,53421 |
| 2SvL8 | 237 | 5,44798 |
| 2ZhCO | 207 | 5,62322 |
| 35DlC | 232 | 5,30202 |
| 3Tb2n | 243 | 4,70720 |
| 3Xanv | 256 | 4,95491 |
| 3g6Qg | 237 | 5,42428 |
| 3z2pR | 211 | 5,64948 |
| 40M6u | 243 | 4,17246 |
| 40ufK | 256 | 4,64257 |
| 45M2e | 254 | 6,11925 |
| 47WYN | 204 | 4,66093 |
| 4EUKx | 299 | 4,42625 |
| 4EVmq | 250 | 4,24896 |
| 4EyPf | 222 | 5,32106 |
| 4FgVf | 243 | 6,06901 |
| 4HUOD | 277 | 4,96008 |
| 4HUXC | 208 | 5,42440 |
| 4QWVe | 228 | 5,30765 |
| 4R1J0 | 209 | 4,88585 |
| 4R1dv | 206 | 5,62555 |
| 4W4pl | 255 | 5,88564 |
| 4W5DI | 253 | 5,69216 |
| 4W6lb | 263 | 5,87365 |
| 4ftcf | 259 | 4,99549 |
| 4gLL1 | 289 | 5,89462 |
| 4jRyF | 231 | 4,90472 |
| 4qCbg | 235 | 5,44031 |
| 4v8RY | 277 | 5,04170 |
| 5B8SA | 240 | 4,99441 |
| 5DQ1A | 206 | 4,79036 |
| 5EsU6 | 206 | 6,58317 |
| 5F7hJ | 252 | 4,45938 |
| 5GVLu | 253 | 4,24800 |
| 5J5NH | 232 | 4,69890 |
| 5J9xS | 237 | 4,63990 |
| 5JfDH | 211 | 4,66650 |
| 5k8dK | 206 | 6,28619 |
| 5n8Gt | 265 | 4,37350 |
| 5nOg9 | 253 | 4,56647 |
| 6CcmC | 246 | 4,63547 |
| 6CcsV | 247 | 4,80570 |
| 6Cct5 | 244 | 4,86817 |
| 6CctU | 246 | 4,65002 |
| 6Cctj | 246 | 4,51668 |
| 6Ccv9 | 250 | 4,84236 |
| 6Ci0d | 246 | 4,63547 |
| 6Dvwc | 282 | 5,41667 |
| 6EodG | 284 | 8,75270 |
| 6F1kG | 295 | 5,46759 |
| 6GJqL | 242 | 4,46035 |
| 6HUYr | 277 | 5,87575 |
| 6HWTs | 255 | 6,31171 |
| 6I22a | 286 | 4,89579 |
| 6I2fi | 263 | 4,62757 |
| 6I5AM | 258 | 4,46444 |
| 6IRUH | 283 | 5,39512 |
| 6IYec | 249 | 4,82321 |
| 6IeLn | 258 | 4,22765 |
| 6Jdby | 280 | 6,22781 |
| 6K8rc | 253 | 4,34497 |
| 6KoYL | 240 | 5,48840 |
| 6RQF9 | 262 | 4,69515 |
| 6TcDh | 257 | 4,74557 |
| 6XCqk | 245 | 4,47496 |
| 6Xyl2 | 255 | 4,14415 |
| 6Y4kU | 234 | 5,24427 |
| 7E5RB | 210 | 5,53012 |
| 7eteK | 220 | 7,75633 |
| 89LP7 | 285 | 7,88972 |
| 8KZb | 210 | 4,86908 |
| 8fvt | 257 | 4,86561 |
| d8Ac | 289 | 9,84550 |
| eesi | 248 | 4,85606 |
| fJ7m | 238 | 4,22526 |
| fOLU | 232 | 5,33647 |
| fxc0 | 290 | 6,16938 |
| iaFY | 212 | 5,25740 |
| jFl1 | 247 | 4,40709 |
| jG6D | 258 | 4,47683 |
| jGrH | 207 | 5,07739 |
| jqnm | 237 | 4,50798 |
| kQm9 | 237 | 4,80809 |
| kRdx | 230 | 5,68119 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_34559
4UNXW
|
287 | 24,1% | 228 | 5.547E-49 |
| 2 |
phalp2_39912
1jXPT
|
300 | 26,4% | 253 | 1.451E-38 |
| 3 |
phalp2_5981
6El6s
|
21 | 23,4% | 226 | 2.373E-37 |
| 4 |
phalp2_5615
4g2xP
|
40 | 27,0% | 218 | 2.082E-36 |
| 5 |
phalp2_29166
7tVP6
|
1 | 24,0% | 220 | 7.499E-34 |
| 6 |
phalp2_15880
4Ajn2
|
3 | 18,9% | 237 | 3.522E-33 |
| 7 |
phalp2_10644
2AeOK
|
60 | 28,6% | 206 | 6.538E-33 |
| 8 |
phalp2_16820
1owxb
|
15 | 30,7% | 228 | 1.653E-32 |
| 9 |
phalp2_17042
7nSW4
|
41 | 28,2% | 237 | 6.849E-29 |
| 10 |
phalp2_35314
79Mal
|
26 | 25,3% | 221 | 1.268E-28 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8jh1R)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50