Protein
- Protein accession
- 6OYVo [EnVhog]
- Representative
- 2cPfi
- Source
- EnVhog (cluster: phalp2_24155)
- Protein name
- 6OYVo
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKAGFMRNWVLLFPDKNLGTRFGVKDAAHPLGHRGVDYNGLKVGTKLKCVADGSTFIQSYWSDALGWISEYQVGKWYVSYCHTKAKSKLKFGAKLKSGDTVALLGNTGSATSGAHVHVTLSTKLGGAVTGPYYDFDEFIKAKVKEDK
- Physico‐chemical
properties -
protein length: 147 AA molecular weight: 16054,2 Da isoelectric point: 9,54 hydropathy: -0,27
Representative Protein Details
- Accession
- 2cPfi
- Protein name
- 2cPfi
- Sequence length
- 143 AA
- Molecular weight
- 15327,34620 Da
- Isoelectric point
- 9,09921
- Sequence
-
MSQLPFPKTKITCKFGVKDAAHPNGHRGTDFGMPAGTEIPSATEGIVALSQWSDVLGWVVVVQRKPKSFWGYCHMEQKGLAVGSKVHAGKTFIGKVGDTGSASHGDHLHFTHGDTVNSVFYGKVDDPVKAIAKLVAEEKLKNA
Other Proteins in cluster: phalp2_24155
| Total (incl. this protein): 141 | Avg length: 162,9 | Avg pI: 9,34 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 2cPfi | 143 | 9,09921 |
| 12HTh | 171 | 9,36211 |
| 16UJO | 153 | 5,37097 |
| 16neE | 196 | 9,30074 |
| 19NTc | 146 | 9,55178 |
| 1I258 | 182 | 9,41949 |
| 1ITrp | 159 | 9,61947 |
| 1JFrE | 161 | 9,35174 |
| 1JQwh | 189 | 9,95516 |
| 1JRmY | 167 | 9,77336 |
| 1JSBS | 181 | 9,38887 |
| 1JWO5 | 186 | 9,47023 |
| 1Jqa5 | 161 | 9,64855 |
| 1Jsr3 | 150 | 9,35161 |
| 1KHzh | 155 | 9,08258 |
| 1KaS1 | 180 | 9,35825 |
| 1KfJ1 | 168 | 9,56345 |
| 1Kluh | 163 | 9,73732 |
| 1Klvs | 193 | 9,39113 |
| 1KmeZ | 161 | 9,45927 |
| 1LCgU | 162 | 9,61012 |
| 1LPWf | 180 | 9,44141 |
| 1Lj3M | 119 | 9,94800 |
| 1LkH9 | 168 | 9,63649 |
| 1LqqY | 158 | 10,00125 |
| 1LquV | 167 | 9,53553 |
| 1Lw5y | 171 | 9,59046 |
| 1M4K0 | 180 | 9,35844 |
| 1cHUE | 145 | 9,62702 |
| 1dVYB | 181 | 9,41749 |
| 1dYAS | 182 | 9,33858 |
| 1fFoU | 170 | 9,44109 |
| 1pFVR | 180 | 9,64281 |
| 1xWBW | 145 | 9,21848 |
| 24Qgp | 181 | 9,32447 |
| 25MhP | 161 | 9,30087 |
| 25NNt | 182 | 9,66408 |
| 25Ns1 | 139 | 9,85046 |
| 2869h | 142 | 9,01592 |
| 2YsXU | 146 | 9,21848 |
| 2cOIh | 145 | 8,85107 |
| 2cPe7 | 149 | 9,71572 |
| 2cPiZ | 148 | 9,57976 |
| 2cS83 | 148 | 9,05666 |
| 2cXNY | 180 | 9,68646 |
| 30dGN | 145 | 9,03133 |
| 30hfs | 182 | 9,79676 |
| 316BF | 174 | 9,37217 |
| 378DM | 146 | 9,33523 |
| 37gY4 | 146 | 9,19546 |
| 38eY5 | 141 | 9,80082 |
| 3b2oA | 157 | 9,49034 |
| 3b6E0 | 174 | 9,03165 |
| 3blIK | 145 | 9,03133 |
| 3bnFM | 182 | 9,79676 |
| 3bq2G | 182 | 9,78084 |
| 463I3 | 175 | 9,63765 |
| 4661D | 146 | 9,21848 |
| 46PrL | 136 | 8,48541 |
| 46Yp8 | 142 | 9,14595 |
| 472xP | 169 | 9,68027 |
| 47ANI | 145 | 9,62695 |
| 47CKL | 145 | 9,62695 |
| 47KCX | 159 | 9,49492 |
| 47cFJ | 174 | 9,37217 |
| 47saB | 183 | 9,19405 |
| 491lb | 147 | 8,76501 |
| 4936H | 154 | 9,57596 |
| 49fB4 | 177 | 9,76021 |
| 4IVQe | 157 | 9,35244 |
| 4ZaXl | 189 | 9,59704 |
| 4abjY | 145 | 9,21848 |
| 4aiXC | 145 | 9,24317 |
| 4au94 | 179 | 9,13377 |
| 4bEuQ | 153 | 8,90897 |
| 4badc | 182 | 9,75550 |
| 4bxCE | 147 | 9,41375 |
| 4gdvO | 151 | 9,20649 |
| 4gfmp | 150 | 9,65068 |
| 4ltdt | 141 | 9,49460 |
| 4m4fj | 168 | 9,56345 |
| 4mdhi | 168 | 9,56345 |
| 4rjul | 177 | 9,57596 |
| 4rl17 | 182 | 9,79676 |
| 50HFa | 161 | 9,45927 |
| 532AT | 173 | 9,79386 |
| 5EGub | 163 | 9,66982 |
| 5EI42 | 176 | 9,27811 |
| 5cXVl | 168 | 9,49505 |
| 5jR3q | 145 | 9,54907 |
| 5kLpo | 189 | 8,84978 |
| 5kTIx | 147 | 9,54340 |
| 5kWY4 | 150 | 7,81971 |
| 5kXw4 | 144 | 9,71572 |
| 5ks0r | 163 | 9,96825 |
| 5l4jk | 120 | 8,84514 |
| 5l5bL | 128 | 9,98855 |
| 5l8T8 | 143 | 9,27695 |
| 5l9ZF | 189 | 9,89314 |
| 5la25 | 169 | 9,33800 |
| 5me5A | 144 | 9,80024 |
| 5zFqp | 184 | 9,40744 |
| 5zGN9 | 153 | 9,43922 |
| 5zK54 | 193 | 9,32814 |
| 6BOfz | 190 | 9,38081 |
| 6BRGb | 181 | 9,31924 |
| 6BSvb | 149 | 9,39557 |
| 6BTIn | 190 | 9,25781 |
| 6BTvr | 156 | 9,49492 |
| 6BXnM | 175 | 9,45869 |
| 6GAdz | 153 | 9,17413 |
| 6GmuU | 232 | 8,93649 |
| 6Gz7a | 169 | 9,08194 |
| 6Gzhi | 184 | 9,16684 |
| 6KVtC | 168 | 9,46610 |
| 6KWdB | 160 | 9,77671 |
| 6KafD | 177 | 9,62785 |
| 6LvWr | 150 | 8,52299 |
| 6Mjwm | 153 | 9,41653 |
| 6Mn2f | 142 | 8,88808 |
| 6Mqr7 | 183 | 9,40370 |
| 6QiON | 149 | 9,69767 |
| 6QiYP | 176 | 9,30042 |
| 6Qiwa | 149 | 9,17438 |
| 6WQI0 | 181 | 9,51800 |
| 7XeJl | 144 | 9,12068 |
| 7XfDs | 143 | 7,80810 |
| 7Xg3m | 143 | 7,80301 |
| 85DWb | 155 | 9,59291 |
| 87cOL | 176 | 8,99329 |
| 88eFk | 183 | 9,08174 |
| 8mGuP | 168 | 9,59362 |
| 8mRdM | 181 | 8,89981 |
| 8mwTo | 145 | 9,18741 |
| 8np8G | 181 | 9,40389 |
| 9Txd | 133 | 7,21192 |
| H2ed | 180 | 9,66408 |
| Iu7O | 147 | 9,71850 |
| TWn2 | 171 | 9,25613 |
| Urks | 145 | 9,21848 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_29414
1iBPp
|
693 | 48,3% | 149 | 2.255E-49 |
| 2 |
phalp2_4831
5ksbg
|
93 | 35,4% | 141 | 3.567E-37 |
| 3 |
phalp2_8002
5ma4R
|
98 | 40,0% | 130 | 1.784E-33 |
| 4 |
phalp2_32059
5JbvR
|
2 | 35,6% | 101 | 4.499E-23 |
| 5 |
phalp2_25623
4b5Xf
|
6 | 37,5% | 96 | 2.171E-22 |
| 6 |
phalp2_10060
7ul5P
|
4 | 28,5% | 133 | 1.047E-21 |
| 7 |
phalp2_40658
5cY9d
|
663 | 31,5% | 133 | 1.434E-21 |
| 8 |
phalp2_5756
7Czmx
|
45 | 33,3% | 108 | 5.081E-18 |
| 9 |
phalp2_3247
2k2so
|
54 | 30,8% | 133 | 5.081E-18 |
| 10 |
phalp2_24104
8fsA2
|
7 | 32,4% | 117 | 2.442E-17 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(2cPfi)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50