Protein

Protein accession
6N6ba [EnVhog]
Representative
RjMA
Source
EnVhog (cluster: phalp2_26274)
Protein name
6N6ba
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MQFISRGEWGALDSGKPLSTFKRVPEGIVVHHTTGSGVDPWQRIKQHDKYHVKTRGWKSIAYNWLVSGETGEIFEGRGWKQGAATKGQNSKTTSISYIGSGDDLTHNGKEAIVAVVEALREEYGDHLWVKCHRDFGTTYCPGDGLATWIKSGMPMVEMQTSVQLEIKLSDMESLSADFRREPLHRGSKGKNVIALQVRLNERIDAGLVCDGAYGRLTEKAVREFQSMYPIRKDGRVGPVTWRYLWTV
Physico‐chemical
properties
protein length:247 AA
molecular weight:27757,2 Da
isoelectric point:9,03
hydropathy:-0,52
Representative Protein Details
Accession
RjMA
Protein name
RjMA
Sequence length
250 AA
Molecular weight
27420,73060 Da
Isoelectric point
10,04548
Sequence
MDYISRTGWGARPPKRGWTTLHPRSVKGIVVHHTAGGAGIAGLHAAEAHHMDVRGWNAIAYNWLIDHHGTIYEGRGWDAVGGATGWLVDRKTVSVCYIGFGSQTLPEAAQRAFLTVVGEAKARFGDGFVRTHRRYKATECPGSFLGDWVEGGMDVAHSPHGVDWDGIGRYIEDLRIQVTGRPLSRWRRSRGEAVRETQKALKRRGFDPGPADGIFGRRTQSAVKAFQRSVGFLKVDGVVGGNTFAALFIM
Other Proteins in cluster: phalp2_26274
Total (incl. this protein): 376 Avg length: 251,7 Avg pI: 9,80

Protein ID Length (AA) pI
RjMA 250 10,04548
10cRM 255 9,79102
115QJ 247 9,33968
12gl9 256 10,29465
16q0b 202 9,85601
17nFv 225 9,20501
1EWwF 251 10,22270
1RY6S 256 9,76582
1STAd 263 9,69226
1SbBt 257 9,56951
1TGTO 251 9,74944
1TLzP 215 9,71830
1TMT5 257 9,86716
1TnDA 257 9,70412
1Tpu8 263 9,76414
1TwZP 255 9,81900
1U9Gp 255 10,34300
1US0x 248 9,59891
1UfV0 252 10,19086
1UiP1 252 10,50379
1Ur29 262 9,92602
1UudW 231 9,43619
1VWIV 263 9,66898
1VWKb 258 9,47210
1VXlp 249 9,36308
1Vd4M 255 9,90023
1VrbI 263 9,64010
1VrmU 255 9,79102
1Vrqs 256 9,71340
1Wedx 256 9,53483
1WqnF 252 10,38516
1Wque 255 9,75892
1ZpcV 256 9,61070
1ZqyO 257 9,93537
1ZsiM 251 9,49131
1g82e 247 10,17925
1gaGm 251 10,08229
1gfml 256 9,82010
1n58T 252 10,14779
1sL6z 256 9,63933
1tA0I 255 10,29839
1va2V 264 10,35100
1vau0 256 10,81846
1wJlK 244 10,45866
1wdnd 244 10,15495
1xXrA 257 10,76114
1ysoF 264 10,35100
22o40 251 10,22270
24Vcj 258 9,83325
24gja 256 10,52609
25HeW 248 9,21687
2AwuD 229 8,99052
2Cagv 254 9,76814
2CjVl 254 9,76814
2HJMx 244 10,08700
2MYcn 253 10,08506
2QpEe 283 10,29465
2Qqaa 256 10,08068
2Qr85 216 9,50311
2QrmC 259 10,26519
2Qsi1 249 9,86426
2Qsoo 250 9,81494
2U388 252 10,32340
2Zwaf 202 4,92671
2Zwd1 256 9,67008
2cpql 248 9,89108
2jUEK 250 9,27573
2jwSm 229 9,27225
2kSrK 252 10,58095
2nygU 247 9,68188
2q1xt 251 9,86033
2rH2R 251 9,57570
2rHdb 254 9,53360
2rMZh 251 9,19978
2rN8E 251 9,41969
2rt9N 254 9,53360
2tCVe 254 9,55713
2tYlB 251 9,19978
2u6AP 253 10,03123
2uPFN 247 9,60974
2ukTe 249 9,23563
2viR2 259 9,46423
2vitM 256 9,83422
2vjH2 254 9,73513
2vjzQ 256 9,57686
2wUWj 257 9,93853
2wpTG 249 10,02395
2wrqf 256 9,80740
2wsZy 256 9,70547
2xKRV 251 10,58469
2xMWA 249 9,25426
2xMz1 257 10,51223
2xRU3 247 9,07916
2xSzl 265 10,86951
2xVY7 244 9,98482
2xoSj 254 9,62134
2yBIl 256 10,40231
2yKIv 249 9,94723
2yLuV 256 9,69335
2ycCf 253 9,92886
2yiPY 256 9,53483
2ymGb 244 10,23005
2yvx1 257 10,86623
2zInl 254 10,25565
2zZfO 249 9,27470
32H2M 195 9,68794
369QI 257 9,70380
36bHQ 251 9,96702
3CI5f 255 10,34300
3D5ta 255 10,34300
3E6W3 244 9,95735
3EIuT 251 9,71224
3Epra 256 9,74519
3FFAf 255 10,31883
3GUwr 256 9,47236
3HR88 248 9,05402
3HSEy 257 10,44254
3HUNk 247 10,28085
3HWJf 257 10,12813
3HYM3 249 9,72675
3HwsR 255 10,34300
3IDd2 247 10,05296
3ILZ5 247 9,77342
3JkKC 256 9,66969
3JnfR 235 9,84253
3KUel 256 9,55513
3KnBn 256 9,69342
3L0dH 252 9,21816
3L1PL 254 9,71353
3L1sI 251 9,78786
3L28x 251 9,64358
3MYL0 256 9,90023
3R1q7 251 9,39983
3Rf6z 254 9,85201
3RfbY 252 9,92402
3RxmL 251 9,82958
3SeJI 252 10,44190
3SevQ 247 9,36843
3Sllt 247 9,26425
3SrUc 247 9,26425
3Ss3Y 256 9,96573
3U3qn 256 9,55546
3U8rF 248 8,78428
3X0zM 261 9,76994
3dy7t 254 9,41859
3eGWT 250 9,67131
3eH2s 259 10,21297
3rJ1B 251 9,88715
40zIJ 257 9,70412
417n3 257 10,97821
41B6T 247 9,74854
41EdI 252 10,32295
48vev 283 10,29465
48wDq 252 10,58095
48wEG 249 10,04071
48yAi 254 9,58273
48yB8 249 9,73203
4H3mS 321 9,46746
4JfWa 182 8,43861
4Jfdo 253 10,03117
4M0Pb 249 9,27437
4N7i5 348 6,44204
4Nj7l 236 9,69052
4OIUR 250 8,62415
4OOOr 250 8,62415
4OPJ3 256 9,63230
4OPyr 266 9,59414
4OY09 251 9,72830
4Osm 247 8,98143
4PU8E 248 8,81549
4QcCX 247 9,16942
4R85T 256 9,99971
4RK1k 257 9,93621
4Rs8P 256 9,76498
4Sx1N 254 10,52583
4UMY1 255 10,25429
4c4iC 254 9,58240
4dGey 250 9,31641
4dH04 249 9,57505
4dIJi 263 9,58079
4hIyi 256 9,71766
4hJMo 254 10,07965
4hL6o 249 8,83051
4hMrL 252 9,80166
4iFXK 264 9,26954
4iXsH 246 9,92525
4jFs3 236 9,60980
4jne0 256 10,45782
4t42t 263 9,58111
4xezT 249 9,19972
5qX1R 244 10,05315
5r2Kz 255 10,27093
5rG6k 256 9,76582
5riER 256 9,83422
5s034 256 9,51349
5satJ 258 9,66576
5spuI 258 9,65545
5ss2W 256 9,71888
5tdaA 254 9,90055
5yDCh 250 10,80124
5yH74 253 9,95007
5yiIK 252 9,90616
6CTlu 249 9,71353
6CTmB 263 9,49054
6Cpn 256 9,89462
6QktH 229 9,79425
6Ql6G 250 9,72875
6Qpfc 227 10,08429
6RDFy 254 9,31550
6RIda 250 9,21687
6WaB7 229 9,44521
6oED 242 6,13647
7CTZ0 249 10,02446
7Cn5x 257 10,69448
7Cosi 241 10,07855
7CxPc 254 9,43890
7DenE 256 10,45782
7Di20 247 9,25432
7In84 261 10,16823
7SPDA 251 10,06824
7STgq 247 10,05296
7SVTd 256 10,42185
7TGyj 256 9,67008
7TK4u 247 10,30090
7TVrm 251 9,71224
7TWA4 251 9,86755
7TX75 255 10,34300
7TXsG 255 10,34300
7TsvQ 249 10,21161
7TtPT 256 9,57628
7UafB 256 10,00480
7VAno 256 10,52609
7VP86 254 9,64977
7WBdx 256 10,24366
7WvK8 259 9,57241
7XA5O 247 9,21841
7XkZj 256 9,80740
7XlCa 251 10,30961
7YTB3 256 9,55513
7qR42 256 9,73023
7qR7V 259 9,60213
80IV7 244 10,29188
81FDo 257 10,14386
81G7V 259 9,57215
81yuT 256 10,50005
83SwM 250 8,47161
83TKF 252 9,96747
84Aag 251 10,58469
86gL4 244 10,07855
889Q6 244 10,07855
88XXJ 248 9,37037
899Xu 252 10,29813
89Bht 247 9,32969
8A2TM 257 10,44254
8AfI4 256 10,00480
8AvtH 247 9,77342
8B5Ga 248 8,77049
8BJrf 244 10,14650
8BNms 247 10,05296
8BY9E 244 10,03555
8CzBm 248 8,78486
8DXJG 256 9,55513
8Dy4C 256 9,78296
8EGRN 256 9,65545
8Er8R 249 10,18802
8ErWG 256 9,67008
8FFiO 256 10,42185
8FIYi 255 9,73984
8FPV4 247 10,13458
8FYk8 254 10,36137
8Fygs 244 10,03201
8GNY8 244 10,00667
8GOKY 255 10,31883
8Gids 244 9,95735
8Gq4f 244 10,07797
8adFz 251 9,93376
8c4av 249 10,18802
8esPH 251 10,27666
8gEXX 256 10,56993
8h5zZ 257 9,70347
8hSOF 246 9,95097
8hSv4 251 9,90720
8jt3e 251 9,71250
8l9pu 247 9,69264
8lle8 244 10,41830
8lrwc 256 9,65583
8o0g2 244 10,07075
8og7c 244 10,03342
8qJ8n 251 10,32875
8qLi 254 9,73474
8qmEk 245 9,95941
8tZHN 255 10,36892
8tZW1 248 10,10247
8tlbJ 244 10,00667
8tr1s 254 9,55713
8uC0H 256 9,97444
8uY27 244 10,07797
8ucRT 247 8,97318
8uvFr 248 8,78486
8uzUu 257 10,33778
8v1f3 256 9,94607
8vEMy 257 9,87902
8wAi0 256 10,46904
8wMKl 258 10,04161
8x1l2 247 8,97298
8xjey 251 10,27666
8xzAP 255 10,34300
8y6JE 244 9,95194
8yMMe 244 10,12684
8z3pk 257 10,46465
8z7bp 256 9,76582
8zV8b 251 9,71224
9Ai7 254 9,78000
9JfH 249 9,21706
9xXS 254 9,70225
CsQh 254 9,33446
DqLZ 261 10,03484
DsG2 261 9,76994
Ekk3 251 9,77632
En8j 261 10,03484
Esw0 248 9,51297
HP6Y 256 9,91422
HTVt 248 9,64868
HWnV 252 10,95700
I2cM 254 9,76814
I873 256 9,86722
Ie0a 254 9,64668
QYhV 256 9,47210
R06W 256 9,83422
RjA6 247 9,51549
W4A8 252 9,88089
WaAt 244 9,95613
WihW 252 10,48586
XdIA 247 9,98198
XdIX 256 9,77549
Xe23 256 9,68175
Y2yj 215 9,34645
YB4L 255 9,81952
YBlt 255 10,18718
YDuM 250 9,56654
YNO2 252 9,88089
YTDv 256 9,91487
Yysn 256 9,79663
Z0IB 253 9,96560
Zbtt 256 10,03484
cjuP 254 10,03742
cm92 254 10,20626
cy2L 254 9,46062
dd0T 263 9,66421
g0nA 257 10,03665
k8qp 254 10,10743
k9c8 251 9,53618
lelp 256 10,61899
pbId 251 10,13967
pbnk 263 9,69226
pl5W 259 9,66537
qqUG 204 9,31776
rYSq 254 9,75988
s08p 258 9,69303
s8PD 249 9,13061
sBuJ 252 10,13670
sdST 256 10,56671
vDrk 251 9,75905
vFBf 247 9,25413
vTMs 254 9,65809
vX6n 243 9,52986
w167 257 9,84356
w1No 254 9,76040
w5H6 256 9,66028
y3az 247 9,20423
y3qw 247 9,18270
zK0B 256 9,76582
zKja 227 9,95845
zKph 246 9,81249
zLBe 261 10,00680
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_15057
7s7pP
172 40,7% 233 5.513E-66
2 phalp2_36432
11r0n
207 32,9% 270 4.928E-56
3 phalp2_37752
4kTIO
51 35,5% 239 2.364E-55
4 phalp2_20947
7lyTA
33 31,5% 285 9.126E-53
5 phalp2_13951
8FOsh
28 35,5% 259 3.436E-47
6 phalp2_5539
3EPBj
12 30,7% 254 1.039E-42
7 phalp2_23216
7DAyW
82 33,3% 180 1.727E-41
8 phalp2_15099
bgFu
21 32,5% 166 1.209E-38
9 phalp2_39859
14dHo
34 30,5% 265 5.089E-37
10 phalp2_39895
1eEek
97 31,1% 170 6.948E-37

Domains

Domains
Representative sequence (used for alignment): RjMA (250 AA)
Member sequence: 6N6ba (247 AA)
1 250 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01471, PF01510

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (RjMA) rather than this protein.
PDB ID
RjMA
Method AlphaFoldv2
Resolution 92.66
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50