Protein

Protein accession
6JKdR [EnVhog]
Representative
3FkY
Source
EnVhog (cluster: phalp2_30760)
Protein name
6JKdR
Lysin probability
99%
PhaLP type
endolysin
Probability: 78% (predicted by ML model)
Protein sequence
MFRKNAVGVFCLSFLIACQPIEETLDISKPAEQYIGLDEYKNRKQLKELVGVDPVHTEWCAAFVNFVLDIQDIPGSESVSDYPLMARSFLTWGEEVLDKPIKGDIVIFPRGGKLWQGHVGFFIREVQYENRTRWIILGGNQDNTVSYAEFNPKKAIAIRRKK
Physico‐chemical
properties
protein length:162 AA
molecular weight:18568,2 Da
isoelectric point:6,74
hydropathy:-0,21
Representative Protein Details
Accession
3FkY
Protein name
3FkY
Sequence length
170 AA
Molecular weight
19243,43370 Da
Isoelectric point
11,60142
Sequence
MLSHKINQVQQKHKSLRKITIFFLFFWLICALATSFSFSQANAAPNMGNIAKRYIGLHEVKHRKKLQNIMGINPRRVPWCGGFVAIVMKRSGKTPPRHYLAAKSYAGWGRRVNERNAKKGDIAVIRNRRGHHVGIVVGKYKNGLILVSGNSSNRVKTGKYSYGSIISVRR
Other Proteins in cluster: phalp2_30760
Total (incl. this protein): 209 Avg length: 165,4 Avg pI: 7,42

Protein ID Length (AA) pI
3FkY 170 11,60142
11Xd5 183 8,95384
14byk 153 10,92438
15c1m 165 6,49513
16nKm 146 10,39890
16rRc 154 9,11958
17nn9 165 5,87962
1AG5y 190 9,86316
1AexX 175 6,04309
1AosM 158 5,08444
1Arw1 176 6,08339
1BSXW 170 5,78294
1BgL7 150 10,59533
1BxOJ 163 6,12107
1F3rx 170 4,83736
1FqGw 167 6,07765
1Fr8t 169 5,02647
1N03w 167 5,91776
1PyAG 189 5,81920
1UNGQ 158 5,36142
1V3iw 177 8,30406
1V9rx 165 8,51294
1VFDZ 168 6,07907
1VKzk 157 5,33658
1YaPO 171 9,36650
1fimj 163 8,46407
1flwf 151 9,34426
1i5p0 164 6,59255
1iJB1 160 5,69142
1lraw 152 9,42149
1pn0I 145 6,42260
1qv3P 159 10,97531
1tc4a 169 5,39114
1vbTk 160 5,78777
1veSF 180 6,72487
1vsDy 170 5,75088
1x1Va 165 6,55924
1yOdB 172 6,42408
20Ppt 172 6,42419
20SFL 169 5,10962
21Ymu 170 4,92938
22cbW 182 5,81909
27T6A 151 10,36047
27cyS 160 6,95666
27wvT 210 4,77313
2H1th 165 4,77410
2H2wM 176 6,51229
2HjWD 131 5,19999
2IlOt 165 4,68628
2JB5x 161 8,47258
2LbE1 164 5,72138
2MCkr 176 9,22583
2Pp2B 172 5,71342
2Q7n 167 8,45459
2QGxI 178 5,18249
2RzEV 150 10,54949
2T8Os 178 6,11925
2T9Ya 178 5,71132
2eM3S 165 6,73692
2eTFd 159 5,89974
2eWG2 164 8,39013
2fDiO 150 5,76696
2fJ1C 177 4,77416
2gGFZ 176 6,31199
2gGFa 179 7,02481
2gGch 178 6,42584
2gs2k 181 5,93566
2hw6j 165 5,85171
2intL 164 5,08279
2n5EU 162 4,81588
2nGBh 126 6,90596
2nJSk 181 7,89720
2nLgH 164 5,58951
2qaxv 172 6,08827
2uMiG 185 5,39711
2vyLT 173 6,08299
2wd8s 166 4,89699
35oSH 165 6,90539
386A5 185 5,63373
386h0 180 6,22662
39HFQ 189 8,73032
3OXUe 177 6,50962
3P3Ue 158 5,31447
3QUBj 164 5,56519
3SKd7 164 5,57451
3TUuG 150 6,91625
3VACK 170 4,73755
3aYHy 175 5,14964
3wH9 170 6,09220
3xxw 162 4,70606
47J3X 151 10,29678
48Tzx 151 10,15823
48uab 172 5,88354
4C25U 165 6,89101
4MlFU 146 10,92064
4NbG2 136 9,92002
4PuRn 150 11,08948
4VmB5 138 10,56780
4W7S7 172 9,63559
4W7hT 164 5,09558
4WP9Y 184 5,67398
4WnJm 190 4,94644
4X1HL 161 7,80559
4Xa4U 169 5,78066
4XrVK 171 8,75837
4aG4o 146 10,98498
4drb8 161 6,89471
4jmLa 170 6,28357
4r31i 167 4,96860
4t4IP 165 7,79025
4vrew 186 5,68779
4vsOX 176 5,93555
4vzZh 168 5,64692
51VHF 183 8,78364
57o8Y 165 6,88629
5Hwar 146 11,05415
5dMSt 165 5,86012
5kIBy 146 10,87435
5l8he 156 11,12842
5rBE6 154 11,54308
5rDbR 151 10,29181
5sYHP 145 4,85640
5vBhB 146 10,75276
5zqKv 189 9,75473
6Bh2B 167 8,57863
6CY3B 198 5,95436
6KQyf 139 9,55887
6LVyk 145 10,96706
6Mr56 159 9,12416
6NN5K 169 7,67022
6NNpK 152 5,29622
6NOqj 165 4,77370
6NOyC 150 4,93297
6O1Cx 164 6,14818
6OLvA 169 6,33257
6OwOs 184 5,48277
6P3jP 156 4,90250
6U4Yl 162 9,21145
6Vxxi 144 11,99997
6W6j 142 10,17519
6Zko 156 10,95158
7DgwZ 139 10,41998
7EI3X 189 5,59190
7FoxV 167 6,50536
7Fvl1 192 5,04141
7GFUU 182 6,42164
7GGdO 171 9,48744
7L0Cl 172 5,34715
7L0Dj 167 5,83472
7L1QL 167 6,04883
7L2H2 177 5,63220
7LWoR 154 5,48118
7LmGn 180 5,80823
7LnXR 178 5,18249
7Sxgo 168 7,75633
7T2XL 192 5,82528
7Vc0b 162 5,75190
7Vc2v 174 5,82295
7XGjc 147 10,96931
7ZWC7 177 10,43519
7g4Kx 147 11,12391
7m9a 158 11,99997
7srQn 131 10,92167
805Md 150 10,90517
80DzT 176 10,37530
82Xtq 153 10,48251
83Zz3 177 9,96825
86qxZ 164 11,33001
87vAB 173 11,13177
88iwB 169 6,28340
8APuR 177 7,00156
8B1fO 144 4,89608
8DLY6 148 5,88257
8DM8R 165 9,27715
8EAEp 158 5,31174
8F2dR 139 10,41998
8G8wD 174 5,82295
8GJyJ 177 6,96337
8dXzR 172 10,96383
8iVwR 163 11,10966
8kz2P 177 11,93653
8mg4D 165 11,62193
8pJWr 128 9,69019
8prWe 162 7,67766
8psag 170 5,67937
8r80C 167 6,81735
8r9dx 153 10,48251
8sWvM 164 11,84460
8sWwg 177 11,99997
BfZd 192 5,12537
BhMD 169 4,79087
DjHx 168 5,40200
IJWL 184 6,33172
JDyC 134 5,49624
P296 153 4,34838
QenZ 178 5,08444
WOa8 150 10,32315
XNWq 165 6,58056
XTAJ 167 8,35570
bwYQ 176 8,48863
cnFn 169 8,35931
dmV9 170 5,68472
kpgB 155 11,12197
tPMu 176 7,05545
vJY2 172 5,11633
vLSF 177 6,30131
xTkj 173 7,00082
xbY0 172 11,20694
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_34569
4WIGQ
127 31,6% 174 2.651E-58
2 phalp2_25664
4tcSb
18 26,8% 134 5.156E-42
3 phalp2_36789
6KVwf
51 29,8% 134 1.352E-38
4 phalp2_18533
6V0pv
14 26,9% 130 1.538E-33
5 phalp2_8732
8njr6
7 27,9% 136 3.588E-29
6 phalp2_31967
4Vkzp
33 25,3% 142 3.588E-29
7 phalp2_32166
6PqA1
486 26,5% 147 4.912E-29
8 phalp2_38999
8dFXu
7 24,8% 137 1.725E-28
9 phalp2_28323
16UXy
9 31,3% 134 6.022E-25
10 phalp2_39271
47VoK
404 25,6% 144 2.887E-24

Domains

Domains
Unannotated
Representative sequence (used for alignment): 3FkY (170 AA)
Member sequence: 6JKdR (162 AA)
1 170 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3FkY) rather than this protein.
PDB ID
3FkY
Method AlphaFoldv2
Resolution 92.89
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50