Protein
- Protein accession
- 6HYKo [EnVhog]
- Representative
- 35AAr
- Source
- EnVhog (cluster: phalp2_15683)
- Protein name
- 6HYKo
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MTDIVISSGHGLKVRGAAEYLDEVNEARRVVDDVAEKLKKIGVAVEVFHDNVSTTQDENLDRIVDFHNSHTRLLDISIHFNAYQPTPEPMGCEVLYATQDTLADDLCDAISHAATFLDRGAKHRTDLYFLNNTEEAAVLIEVCFVDSMMDAELYLRNFNAICDSIARTVAIFIGEEVNE
- Physico‐chemical
properties -
protein length: 179 AA molecular weight: 20008,2 Da isoelectric point: 4,51 hydropathy: -0,09
Representative Protein Details
- Accession
- 35AAr
- Protein name
- 35AAr
- Sequence length
- 183 AA
- Molecular weight
- 19714,13960 Da
- Isoelectric point
- 6,58942
- Sequence
-
MRKTIAISSGHGLLVRGASGVIDEVDEARRVTDRVAELLRGMGNTVAVFHDDTTRTAADNVNGLVRWHNAQTRDIDVSVHFNAVEGRTPNPIGTEVVVHPSAPQPARALASRVAQAMATAGGLRLRRLGTHPGVLELNVGFVRECRQSPILLEVCFVNSEADSRLYNDNFEKICVAIAEALAA
Other Proteins in cluster: phalp2_15683
| Total (incl. this protein): 164 | Avg length: 226,1 | Avg pI: 7,15 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 35AAr | 183 | 6,58942 |
| 117le | 194 | 6,29193 |
| 1183K | 245 | 10,04245 |
| 118yq | 262 | 7,14116 |
| 11DL5 | 138 | 9,47713 |
| 11EVr | 249 | 9,61380 |
| 135a8 | 235 | 6,70032 |
| 15FDA | 215 | 4,83867 |
| 15MMw | 204 | 5,02658 |
| 16JvE | 262 | 4,80491 |
| 1DSsm | 215 | 4,38754 |
| 1FR5E | 213 | 4,34917 |
| 1FSLX | 219 | 4,33223 |
| 1IsR4 | 229 | 5,07324 |
| 1Ithi | 210 | 4,39834 |
| 1Y02n | 230 | 4,67946 |
| 1Zd5W | 221 | 4,52975 |
| 1brjh | 217 | 4,50014 |
| 1c2Cv | 243 | 7,72728 |
| 1dvmx | 242 | 6,38725 |
| 1jLl7 | 258 | 9,30010 |
| 1jQ8q | 263 | 9,30035 |
| 1jRUC | 245 | 7,75297 |
| 1jpbn | 209 | 5,31845 |
| 1k4sA | 222 | 8,42861 |
| 1kaWi | 261 | 9,49376 |
| 1mHqO | 243 | 8,85178 |
| 1pKhk | 162 | 5,08461 |
| 256YP | 260 | 4,79792 |
| 257SI | 330 | 4,80411 |
| 25khZ | 179 | 4,67992 |
| 2ChrP | 264 | 9,47506 |
| 2dSwW | 245 | 8,35615 |
| 2eu4l | 252 | 7,82113 |
| 2fXhx | 216 | 9,07723 |
| 2g0bU | 245 | 8,65103 |
| 35A0H | 218 | 10,72388 |
| 35Aau | 240 | 5,57257 |
| 35zUF | 248 | 6,52457 |
| 35zd1 | 247 | 8,20156 |
| 35zvc | 180 | 6,79092 |
| 3673s | 251 | 7,01697 |
| 3X2Bh | 176 | 4,68589 |
| 3nIx7 | 217 | 9,22467 |
| 3vitr | 215 | 8,99535 |
| 3vnjI | 217 | 8,90761 |
| 3xNak | 225 | 9,13905 |
| 40tZ6 | 177 | 4,33815 |
| 45ygw | 217 | 8,76050 |
| 4EIac | 238 | 4,61080 |
| 4EIwj | 183 | 4,69322 |
| 4EP7E | 170 | 5,00782 |
| 4EQIc | 180 | 8,85159 |
| 4ERnW | 249 | 6,58806 |
| 4ESbL | 351 | 4,62166 |
| 4EnUG | 209 | 4,65013 |
| 4F0Xa | 127 | 5,72320 |
| 4IjCz | 212 | 4,72209 |
| 4W2R1 | 208 | 4,95337 |
| 5F62M | 212 | 4,62450 |
| 5GBig | 213 | 4,27562 |
| 5GX9M | 232 | 5,09081 |
| 5H0ul | 213 | 4,49900 |
| 5QWCR | 220 | 8,63214 |
| 5RpCC | 227 | 8,61815 |
| 5UxDJ | 222 | 8,37710 |
| 5VsbN | 225 | 9,44850 |
| 5YOhp | 222 | 8,61776 |
| 5Ye5i | 254 | 9,03320 |
| 5moWA | 173 | 7,58945 |
| 5nKZ9 | 220 | 4,70260 |
| 5nKgv | 222 | 4,75432 |
| 5nLgn | 224 | 4,78285 |
| 5nLhj | 226 | 4,68969 |
| 5nMKx | 154 | 6,09191 |
| 5sYYl | 259 | 4,40607 |
| 60LN2 | 225 | 9,38822 |
| 60Ml2 | 224 | 9,20816 |
| 60TFA | 223 | 8,44886 |
| 61AFJ | 254 | 9,11694 |
| 64m2N | 221 | 8,44853 |
| 65pQZ | 221 | 8,74122 |
| 67W0P | 232 | 9,21642 |
| 6CcK4 | 217 | 4,40914 |
| 6DDpd | 222 | 4,70714 |
| 6DMMZ | 244 | 4,41897 |
| 6EB0D | 177 | 5,74980 |
| 6Enxe | 318 | 4,45171 |
| 6EqHe | 210 | 4,79723 |
| 6F9h2 | 202 | 4,40095 |
| 6FV1r | 196 | 4,46416 |
| 6GtMb | 208 | 5,93856 |
| 6HRVO | 150 | 6,42362 |
| 6HZqg | 176 | 4,44210 |
| 6HZxH | 219 | 5,01982 |
| 6I2uC | 249 | 4,86851 |
| 6IMCS | 220 | 4,60029 |
| 6IgoI | 246 | 4,87232 |
| 6J42s | 288 | 4,55601 |
| 6KMmb | 181 | 4,60796 |
| 6Qzja | 216 | 9,27766 |
| 6S0yU | 227 | 4,67151 |
| 6S6i8 | 184 | 4,41408 |
| 6U9OX | 208 | 5,23126 |
| 6UMyV | 222 | 6,59397 |
| 6XQzm | 218 | 5,45810 |
| 6XT2L | 217 | 5,29020 |
| 6bzx1 | 222 | 8,39838 |
| 6dxrg | 224 | 9,36025 |
| 6gYNX | 221 | 8,57579 |
| 6hDln | 227 | 8,74406 |
| 6hH7y | 226 | 8,62505 |
| 6hiQ4 | 226 | 8,42952 |
| 6iOcf | 222 | 8,37710 |
| 6jcoY | 217 | 9,27624 |
| 6laCd | 224 | 8,85597 |
| 6mmVi | 224 | 9,23827 |
| 6nXpC | 226 | 8,13051 |
| 6nvvA | 219 | 8,45227 |
| 6o49P | 217 | 9,15698 |
| 6pqRF | 225 | 9,38822 |
| 6tjuX | 225 | 9,43264 |
| 6uVwc | 225 | 9,06530 |
| 6wuZn | 225 | 9,33523 |
| 7Bzkp | 254 | 7,89804 |
| 7PplX | 254 | 5,94396 |
| 7bkPn | 219 | 8,96615 |
| 7hi7K | 271 | 9,26116 |
| 7hi8a | 262 | 8,87680 |
| 7hi9g | 264 | 9,02733 |
| 7hiad | 262 | 9,31067 |
| 7jTxi | 237 | 7,72137 |
| 7pluj | 247 | 9,07194 |
| 7pol8 | 224 | 9,26380 |
| 7rSMM | 271 | 9,22248 |
| 7rT6R | 270 | 9,21384 |
| 7seKF | 247 | 9,51903 |
| 7vFx7 | 258 | 9,40808 |
| 7w6dU | 261 | 9,25619 |
| 7w6f6 | 271 | 9,12416 |
| 7w6gm | 270 | 8,62943 |
| 7wNow | 258 | 9,53134 |
| 7x5Bs | 243 | 6,17672 |
| 82pMI | 220 | 9,20578 |
| 82tgT | 264 | 9,52831 |
| 82zVT | 168 | 9,43683 |
| 84Mx2 | 230 | 9,09734 |
| 85mFm | 216 | 9,28798 |
| 8gj0s | 222 | 9,03320 |
| 8hrKU | 281 | 6,82519 |
| 8lSEJ | 253 | 9,36231 |
| 8lWRo | 203 | 7,03288 |
| 8lcqN | 226 | 8,63220 |
| 9V6X | 173 | 6,57322 |
| CGv4 | 262 | 9,58750 |
| CH4F | 333 | 9,42039 |
| RAq2 | 180 | 4,92887 |
| TijW | 252 | 4,32814 |
| aL6d | 251 | 7,00338 |
| fJ7O | 175 | 10,14005 |
| kRG5 | 174 | 4,38640 |
| wdjH | 181 | 9,25929 |
| zlK7 | 224 | 9,22712 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_2704
7cWsF
|
33 | 49,1% | 183 | 4.499E-74 |
| 2 |
phalp2_11988
35NoL
|
2 | 45,6% | 182 | 9.715E-59 |
| 3 |
phalp2_26504
3NtOf
|
17 | 40,3% | 151 | 2.060E-56 |
| 4 |
phalp2_7005
82zuE
|
2 | 36,4% | 192 | 4.464E-51 |
| 5 |
phalp2_6374
7yZe6
|
41 | 32,7% | 183 | 1.192E-44 |
| 6 |
phalp2_36719
6eCmw
|
993 | 34,8% | 178 | 1.079E-43 |
| 7 |
phalp2_8961
3yVzG
|
53 | 29,2% | 164 | 5.311E-37 |
| 8 |
phalp2_19930
6wdij
|
24 | 31,4% | 178 | 1.863E-30 |
| 9 |
phalp2_23331
5tGuH
|
43 | 25,7% | 175 | 1.863E-30 |
| 10 |
phalp2_35186
67E6C
|
93 | 27,0% | 181 | 4.773E-30 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(35AAr)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50