Protein

Protein accession
6BniN [EnVhog]
Representative
2vySa
Source
EnVhog (cluster: phalp2_21606)
Protein name
6BniN
Lysin probability
79%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MRDINKIIIHCSATREGQAFSVDTIKQWHLNRGWSDVGYHYVVHLDGSISYGRDINKRGAHTKGHNTGSIGICYIGGVEDDGKTPKDTRTPEQKESLLELIKVLKKLNSSAVVHGHRDFAAKACPSFDATTEYKDI
Physico‐chemical
properties
protein length:136 AA
molecular weight:15137,9 Da
isoelectric point:8,42
hydropathy:-0,57
Representative Protein Details
Accession
2vySa
Protein name
2vySa
Sequence length
86 AA
Molecular weight
9596,63420 Da
Isoelectric point
6,49644
Sequence
MRPIKTIVVHCSATHEDMDIGAEEIRKWHVDERGWTDIGYHFVIRRDGSIEDGRSLERPGAHVKGNNTDSIGICWVGGTSKANGRP
Other Proteins in cluster: phalp2_21606
Total (incl. this protein): 303 Avg length: 138,7 Avg pI: 7,04

Protein ID Length (AA) pI
2vySa 86 6,49644
16qgG 93 6,27601
18wEq 103 6,42277
1Ar2b 144 6,09828
1ArjF 146 6,20991
1AtsS 150 8,74741
1Avmj 143 6,05235
1AzWB 142 7,73939
1FsDo 142 6,58698
1I5uW 144 9,03075
1Jrch 144 8,87003
1Pq3F 80 9,34252
1Pyr5 144 9,16259
1TSRW 142 7,83331
1UDLq 142 6,58613
1VLCc 145 6,29687
1cLVE 138 9,25252
1kzEZ 157 6,74204
1kzyG 126 7,76201
1m1m 142 6,58374
1nhIt 137 8,45737
1oOWj 158 6,43454
1s0ug 142 6,29562
1s923 64 8,93179
1sZsd 142 6,28755
1tSDn 144 8,28762
1tgYo 150 6,33552
1v5q6 53 5,98500
1vhDh 142 7,00230
1wI5c 145 6,49393
1wvQZ 142 6,06145
1yP3T 149 7,84156
1z6MD 142 6,64757
1zVO0 142 7,04493
1zrOH 142 7,69392
22guU 142 6,58772
22vjU 143 8,23985
260uQ 144 7,09864
28Ms4 142 6,04945
28UFO 143 8,36840
28Z8d 142 7,71103
2ALaP 121 5,83955
2Bw28 145 5,78743
2HWjE 99 9,51510
2IMmO 136 7,12974
2J1ZA 143 6,99457
2Jbl9 142 6,29557
2K3pl 144 6,65041
2N0dZ 142 6,29557
2N61p 142 7,00105
2NLCR 100 5,64271
2OG4M 200 7,78857
2PzxO 102 6,02240
2QQZd 145 6,74897
2QU8T 142 6,05826
2QrzC 143 6,73698
2V88h 164 7,15798
2Vmbe 137 9,45824
2YMHl 147 7,65521
2Zf4G 147 8,78525
2eBMu 142 6,29335
2fAgH 143 6,04684
2mUt9 135 8,79254
2q8LS 165 9,78735
2qKUd 142 5,60259
2ruk7 142 7,68994
2tWPT 143 6,04604
2tWjZ 145 5,68273
2tXlh 145 5,62759
2vCpC 149 7,83492
2vssh 180 8,31760
2xTkm 71 6,48819
2z0RL 147 8,98491
2zOWO 149 7,05437
2zSLW 138 6,63723
2zgGt 143 7,65464
2zhJC 144 9,19849
2zifs 147 7,65521
34OVS 144 5,58894
395Ae 142 6,29199
3B3s 80 5,87808
3D5NJ 142 6,28903
3DOHs 142 6,05042
3E1mf 78 8,98736
3FUJp 142 6,31773
3H4pM 144 8,91412
3HtEP 142 6,29136
3IQap 68 6,89016
3IiUs 142 6,06832
3Ij4p 142 6,29130
3JJc7 144 6,70333
3Jt6g 146 6,33285
3L5YS 142 6,29346
3OMpd 144 9,23402
3RGFP 136 7,05266
3RHZC 144 6,14824
3RL9V 146 5,54234
3RaRL 149 5,94925
3TVt1 144 9,16259
3Vyco 147 6,44733
3ZfVW 142 6,15432
3Zhx1 145 8,94494
3aPLo 145 6,70367
3aU54 146 6,11721
3ajgP 87 9,50272
3bW39 135 9,26445
3gDu0 148 7,71950
3gyko 145 8,92857
3hO6m 131 7,87747
3hk79 140 5,00896
3mMrm 161 8,59874
3mR9H 147 7,67965
3mT06 145 5,78424
3rN8F 69 6,48814
3t23X 138 9,09644
3uWQQ 138 8,94533
42BgQ 144 6,58903
45Ouo 139 4,89028
48ryD 144 6,37264
48svn 142 6,37162
4KQFn 181 9,47248
4NDdE 126 9,09767
4NEE5 98 9,04126
4OGWV 142 7,00190
4PZDg 142 6,04945
4Pgk 142 6,05366
4Qfp6 92 9,34252
4TZ83 143 6,27380
4VPDi 137 8,82335
4W9qB 135 6,35337
4WdLj 135 6,63666
4XaMW 179 6,88561
4iKT9 73 8,66167
4ivvW 85 8,49347
4joDM 146 6,11834
4jveR 144 6,03831
4qYat 139 6,64768
4rX1L 135 6,70498
4rXvu 142 7,00094
4t4Vi 144 7,09916
4te4n 135 8,78706
4uZD0 192 8,61157
4uzgh 160 5,58377
4vQVj 143 6,80945
4vc51 144 9,35373
4zd00 167 9,23389
5Ah1n 110 9,46359
5Dewl 128 5,80823
5PJHH 132 9,01824
5yCnv 144 6,37355
5yMtD 144 7,09864
5ycq3 144 6,64700
6AKYf 88 7,01680
6ClUZ 142 7,00139
6EUoN 142 6,58641
6Fsl 180 6,24441
6G7te 142 7,00105
6G87v 142 7,74405
6HNrw 136 8,32759
6JUZT 136 8,67005
6NHMs 142 6,06145
6NIXO 142 6,58630
6NNxI 142 7,00048
6Nqsn 144 7,09791
6Ny5N 140 6,28710
6ODSE 142 7,03760
6Oo1f 142 8,28749
6OyYv 142 6,29119
6P0Qn 142 7,68994
6TAAP 142 6,14500
6TCY2 89 6,20184
6ZNB 96 6,27454
6fCtU 147 8,71376
6pJq4 147 8,71376
6ti7M 137 9,47068
7CHKu 144 7,09728
7CJtF 142 6,15432
7CoBq 144 5,77208
7CpRR 94 6,49734
7Cvj5 144 5,77208
7CwIc 144 7,07591
7EKtP 142 6,37037
7EeW1 120 6,61313
7Ega1 141 5,36875
7Emkb 188 8,35132
7HFD3 147 6,44664
7Hcab 142 6,28755
7IQXW 142 6,05826
7IguO 110 6,20485
7TTDe 142 6,05394
7UVkm 142 7,68994
7UoDU 136 8,34764
7UrB6 142 7,00094
7Usqr 144 5,83284
7UxCu 144 6,43630
7V9io 144 6,49081
7VfpP 142 6,06145
7VhkG 144 7,83376
7WKBp 149 8,47864
7Wcy6 144 6,22668
7XiwW 142 7,00054
7Xk23 138 6,68923
7ZNJO 142 6,58482
7ZOKY 142 6,04945
80IJI 142 6,22975
80IPR 142 6,05366
81ifp 131 6,20190
81m1j 143 6,64399
81wMV 142 6,05684
82gc9 144 6,57970
82mDF 142 6,29341
83Z1u 149 5,94925
83zkL 142 6,29108
85Ap5 142 6,29420
85Aqi 87 6,99849
85Rka 144 6,70333
85zce 142 6,15256
86ULq 150 5,81482
87FUX 142 6,70350
87OfS 142 6,39378
88hft 147 6,49814
88iTZ 144 5,83619
89BrO 144 5,42729
89nWO 143 5,84108
8AgRX 142 6,29136
8AzX1 89 9,42749
8B4gA 90 9,23015
8B6wP 144 6,28818
8BHQf 142 6,58465
8BLTS 142 6,28897
8BQXE 141 7,70586
8BYpE 141 6,50633
8Bhgm 105 9,80624
8Bz1B 142 6,29346
8CHRt 145 6,49143
8CKZo 144 6,57970
8Cc8k 142 6,29108
8Cncr 145 5,62759
8DbXx 79 8,68694
8ECUy 142 8,30393
8ECXa 145 8,70841
8ERYz 186 9,95490
8EYmT 145 5,78743
8EfvN 143 5,43997
8EiPT 152 5,00254
8FI3B 142 8,31418
8G3gO 141 6,50934
8GErK 143 7,08296
8aSqz 142 7,00145
8c4AY 143 6,42681
8dzkc 157 6,82110
8e4br 145 8,70841
8igS2 145 8,70841
8jVLp 142 5,46589
8k5nF 143 8,37833
8ktpQ 149 6,65473
8lOdW 142 6,29108
8qLTd 142 6,29108
8qjjx 142 6,28897
8tYm5 142 5,85370
8uCzc 144 5,83619
8vm0d 143 7,08296
8x2VL 144 5,94379
8xHJ5 142 6,29130
8xPWW 144 6,70333
8xRIG 144 7,05783
8xUZ8 144 6,37201
8xkuz 145 5,85518
8zIS2 142 6,29562
8zQ9a 80 8,90742
8zRwK 142 6,58698
8zVaJ 142 6,29113
8zebb 145 5,78424
EaWh 142 6,05201
Pyhm 192 6,65462
RdBb 142 6,04945
RpTc 150 5,20437
WAPh 160 5,82466
WN1G 143 6,69497
WOmS 121 6,06878
aSvL 145 7,05289
prCc 144 9,18180
tiqu 142 6,99827
uOge 70 7,92905
yNt5 142 6,11516
A0A0F7IJV6 153 9,12081
A0A088FB20 141 7,77503
A0A2I7QJ80 152 6,02433
A0A2I7QKU5 152 5,94851
A0A2I7QVR7 152 5,94851
A0A2I7R074 152 5,94851
A0A2I7R0C9 152 5,94851
A0A2I7RCA5 152 5,79464
A0A2I7RGA4 152 5,79464
A0A2I7RHA2 152 5,95050
A0A2I7RT23 152 8,28214
A0AAE7XXL5 152 7,72410
A0AAE7Y387 152 8,28008
A0AAE7Y3G2 152 8,59262
A0AAE7Y3I6 152 8,28008
A0AAE7Y4J6 152 7,72410
A0AAE8CBM3 152 8,28008
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_27860
8AZLJ
3 58,9% 78 9.742E-35
2 phalp2_27898
ipdG
164 58,5% 70 1.304E-30
3 phalp2_14978
yv9W
17 47,6% 63 1.277E-26
4 phalp2_39718
8z0Eo
35 59,7% 67 6.228E-26
5 phalp2_10521
87KcW
27 59,6% 62 2.213E-25
6 phalp2_9904
2GCXD
1 52,1% 69 1.255E-22
7 phalp2_25923
64Nde
24 45,2% 73 2.991E-21
8 phalp2_32271
7BWDU
12 41,7% 103 5.640E-21
9 phalp2_37043
NDSw
22 40,6% 86 1.847E-19
10 phalp2_26108
2kvR
27 37,5% 56 1.333E-15

Domains

Domains
Representative sequence (used for alignment): 2vySa (86 AA)
Member sequence: 6BniN (136 AA)
1 86 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01510

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2vySa) rather than this protein.
PDB ID
2vySa
Method AlphaFoldv2
Resolution 96.99
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50