Protein
- Protein accession
- 61Dim [EnVhog]
- Representative
- 1345B
- Source
- EnVhog (cluster: phalp2_30939)
- Protein name
- 61Dim
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MVSTFTNLDYQVGKYFKVREFQSKDGYPTVLIDDNLVDLLDQIREYFGKPVVITSGYRTKSHNAAVGGVSNSQHTLGKAADIQVTGVPPVAVQTYVYDHSKYTVGTYTTFSHVDTRTTVKLFRGNTEFVRANYEKYKAEEIKEETEMAEKRYQKLEEIPDYAKEIIEDLIKSDIIKGTGEGLNLTEDMLRVIVICYRMALTNANNIYQLVKILGGETK
- Physico‐chemical
properties -
protein length: 218 AA molecular weight: 24748,8 Da isoelectric point: 5,87 hydropathy: -0,39
Representative Protein Details
- Accession
- 1345B
- Protein name
- 1345B
- Sequence length
- 241 AA
- Molecular weight
- 26398,39560 Da
- Isoelectric point
- 9,84866
- Sequence
-
MSFNTPAVKTYSLRRDGDKQLSPNFRVREFASRDGSDKILICDNLVRMLQTIRDHFGVPVSITSGYRSPRHNAAVGGASNSQHVLGTAADITVRGITPRAIAQYAEWLGAGGIGLYLRSNFTHVDTRRVRSRWTQNANGIVVNTPGGFPGFIPPPPTQPEEDEDMAIVNELRKIQGLENVTATEVANLLAFALRHPNPTGAAEKEFDEAVRAGISDGSNRSAVAPRWQTTLMAYRASKRNK
Other Proteins in cluster: phalp2_30939
| Total (incl. this protein): 93 | Avg length: 214,6 | Avg pI: 6,72 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1345B | 241 | 9,84866 |
| 118Ku | 182 | 8,57753 |
| 1naP7 | 218 | 5,87024 |
| 21jF9 | 210 | 9,38494 |
| 234tL | 223 | 8,61048 |
| 23MUJ | 226 | 8,46852 |
| 23aCV | 219 | 6,12442 |
| 24KSU | 223 | 6,44551 |
| 2wws | 218 | 5,87024 |
| 3B4l1 | 218 | 5,66471 |
| 3JX7X | 232 | 7,65635 |
| 3JXgZ | 226 | 5,44736 |
| 3p93E | 218 | 5,78186 |
| 3qgqD | 218 | 5,87024 |
| 3uEVk | 220 | 6,38929 |
| 3vwmZ | 218 | 6,12744 |
| 3yxSL | 218 | 7,02095 |
| 4VPgX | 218 | 5,87024 |
| 4z5q6 | 220 | 6,39089 |
| 4z7KT | 218 | 5,87024 |
| 5K9YY | 218 | 5,87024 |
| 5LGGp | 218 | 5,87024 |
| 5MRsr | 218 | 5,87024 |
| 5P5gc | 218 | 5,66471 |
| 5PyK1 | 200 | 9,13138 |
| 5Qg3S | 218 | 5,87024 |
| 5RrHd | 218 | 6,12744 |
| 5RvDd | 218 | 5,87024 |
| 5SCIw | 218 | 5,87530 |
| 5UXNU | 237 | 8,72491 |
| 5VmGC | 218 | 5,86507 |
| 5Vusg | 218 | 5,87024 |
| 5WiOW | 218 | 5,87530 |
| 5Y4om | 218 | 5,87024 |
| 5Y6R1 | 218 | 5,87024 |
| 5YCVc | 218 | 6,12511 |
| 5YuIa | 218 | 5,87024 |
| 5ZzHx | 237 | 8,71685 |
| 5jEAk | 217 | 8,65980 |
| 610AM | 218 | 5,87024 |
| 62nTs | 218 | 5,87024 |
| 63L8f | 218 | 5,87024 |
| 63LkY | 218 | 5,87018 |
| 63kOT | 218 | 6,12511 |
| 65aMZ | 218 | 5,87024 |
| 66Fjh | 237 | 8,71685 |
| 66RT9 | 218 | 5,87024 |
| 66txA | 218 | 5,65317 |
| 67Udr | 218 | 5,86507 |
| 68HFD | 218 | 5,87024 |
| 6bdbg | 218 | 5,87024 |
| 6c023 | 218 | 5,87024 |
| 6cyeY | 237 | 8,52718 |
| 6dSPS | 232 | 8,71685 |
| 6dXDu | 218 | 5,67130 |
| 6daVY | 220 | 5,99080 |
| 6daWK | 218 | 5,87530 |
| 6f6qk | 218 | 6,12744 |
| 6hrZz | 218 | 6,12511 |
| 6i6iA | 218 | 5,87024 |
| 6iF7r | 218 | 6,12511 |
| 6iOCl | 237 | 8,71685 |
| 6kVJK | 218 | 6,12158 |
| 6kbZJ | 218 | 5,87024 |
| 6kyKr | 232 | 8,71685 |
| 6nL0n | 218 | 6,12511 |
| 6pxV6 | 218 | 5,65317 |
| 6qICm | 218 | 5,87024 |
| 6rFVa | 218 | 6,12749 |
| 6sGf1 | 218 | 5,66471 |
| 6tZhw | 218 | 5,87024 |
| 6tcyB | 237 | 8,72491 |
| 6uHXA | 218 | 5,87024 |
| 6vGDe | 226 | 5,42871 |
| 6wkPC | 232 | 8,71685 |
| 7WDdR | 218 | 6,23145 |
| 7WiIq | 231 | 9,13667 |
| 7ZMra | 229 | 8,32927 |
| 8cwWp | 230 | 9,23131 |
| 8d7Xt | 231 | 9,20172 |
| 8jpuS | 231 | 9,13660 |
| 8kXxm | 218 | 5,87513 |
| 8qUx0 | 218 | 5,87024 |
| BABx | 218 | 5,87024 |
| N65b | 218 | 5,87530 |
| A0A4P8W3P6 | 171 | 8,14353 |
| A0A858NIX5 | 130 | 6,83849 |
| A0A8S5N9Q9 | 135 | 4,60512 |
| A0A8S5PWN9 | 162 | 4,77012 |
| A0A8S5VF67 | 94 | 9,34058 |
| A0A8S5VLQ1 | 137 | 9,46436 |
| A0AAU8AZ14 | 149 | 8,46162 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_21310
1GQff
|
14 | 33,7% | 252 | 1.777E-36 |
| 2 |
phalp2_24864
3s40
|
583 | 40,3% | 151 | 4.540E-31 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1345B)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50