Protein

Protein accession
5yodr [EnVhog]
Representative
5ni24
Source
EnVhog (cluster: phalp2_16330)
Protein name
5yodr
Lysin probability
99%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
AKFYGSAGFESITRVLKEGATKAERYQQMPQALSLYVKAGGRTLPGLVNRRHREGEIWQREDDGTMKFIAQQDTLLKKAPIDSHYLSEAGKKPVAKGELLAVSKLDEIPSDSHAWVTLHGSGERWALFAPHWLEEQAKPAPASSAAINWSDFACPVGKYVTVGEVLQYDARRAPKAGSAEEKAIIEVCKQFDAIRTAWAGPLGITSGYRPEPINSQVGGVPGSYHVKGMALDIYPIGESLQKFHEWLVQRWSGGYGDGRPRGFIHIDTRNGGKFTARAGVKPSAIWDY
Physico‐chemical
properties
protein length:288 AA
molecular weight:31679,5 Da
isoelectric point:9,03
hydropathy:-0,44
Representative Protein Details
Accession
5ni24
Protein name
5ni24
Sequence length
363 AA
Molecular weight
40793,49280 Da
Isoelectric point
7,13724
Sequence
MEHPAIKGAIELLEEFEGLHLEAYLCPSGVWTIGLGTTFYPDGTPVQAGHRCTKQQAYQWAAQELGRINQQLDSLVRVEISRLQRTALLSLVYNVGVGAFSRSRLLEKLNRGDFYGAAGEFDDWVHGAAGEVLPGLVKRRAREKVLFLADVNPPKSEFVFSNFFKYYDERNPKHRNAVEELAKHIPPEQLSDSANWVRIYRSPWPEIKPGGGESGNHVAAQESVRRVTCPGIDWQNPNARVSEFFSVREVTNGDPKRIPTDPQIKANILRLAGKLDKLRRDWGGPIGVTSWYRPPAINAAVGGVPNSTHIDGIAADIYPIDRDGQEFEEWLDLRWEGGLGYGQRSGLGFTHVDLRPGRLRWRY
Other Proteins in cluster: phalp2_16330
Total (incl. this protein): 119 Avg length: 381,9 Avg pI: 6,26

Protein ID Length (AA) pI
5ni24 363 7,13724
15szn 398 7,78148
18MPS 392 7,88153
1RIVJ 339 5,19948
1SAfi 390 5,82397
1Sde6 381 5,07495
1SeIb 424 5,21034
1TDPg 417 4,95354
1U6ti 339 5,19954
1UUPy 383 4,93274
1UUZR 340 5,88013
1UafF 390 5,93373
1VCrR 374 5,36187
1VH4G 359 5,82488
1VHd6 367 6,01768
1VI4P 374 5,67704
1VX7u 383 5,01862
1VYoS 374 5,30213
1Vd1F 390 5,05017
1VhYM 383 4,93126
1Wcnh 376 5,43645
1WeUD 381 5,20892
1fLdL 342 6,22804
1g4g1 340 6,27982
1gb3w 375 5,04812
1qjib 388 7,66317
1uKEy 388 8,70222
1uQfL 375 6,62267
1wH8t 395 5,31305
1wZk7 388 7,64777
1zClf 396 8,80653
1zpkz 384 9,07813
2K62w 388 8,23115
2RiKj 388 7,58411
2U0eC 388 5,24854
2U3Qi 388 5,36062
2g9fW 392 5,44076
2vJvI 381 5,10803
2vKu1 395 5,49044
2wqWM 374 5,49237
2wsMM 376 5,28343
2wsn2 376 5,30964
2wtd8 381 5,12821
2yrZa 367 5,43286
2yue3 376 4,85697
2zXfo 390 5,64067
2zxKf 381 5,77862
31Yre 397 8,42339
37hGp 397 8,42945
3BD1A 374 5,49237
3CnkY 381 5,43866
3EPfx 376 4,95627
3GBxS 390 5,52415
3GSGA 376 4,86504
3IJmv 395 5,59349
3IQxd 381 5,17197
3Itw8 371 5,06358
3Iyf9 381 5,17231
3KIiY 391 5,64470
3UMhO 393 8,24836
3UnbS 383 5,01862
3Wm3S 400 6,78393
3rLwq 395 5,54813
43GsI 388 8,75663
43voU 392 8,81994
46X1y 388 7,66908
47YFW 368 8,29948
4A4gL 388 8,44254
4BSsj 379 8,15746
4BX4d 388 8,58514
4RWOa 394 5,53188
4WDSs 392 5,34874
4fCRu 388 8,59172
4rwsS 397 5,86666
4sNYv 388 8,52815
4uvKr 386 5,24552
4vFGm 367 5,44849
52cGB 392 6,24595
5cNhT 399 5,97016
5fH2B 392 8,42848
5lgeR 388 8,23334
5m6SU 366 6,45790
5rGaa 339 5,19437
5zuX9 400 8,89517
6LZbh 369 8,17287
6Lq7t 393 6,55805
6X0pt 395 5,22688
6x7RV 388 8,40818
7ItR6 381 5,27684
7TY40 390 5,72820
7VEZJ 390 5,19738
7Y2bC 391 5,64470
7oqkP 376 5,42644
7rrYP 325 6,20593
8Avgz 381 5,17231
8BrnD 381 5,11445
8equ0 391 5,68017
8fET5 381 5,27929
8g1m1 374 5,49237
8g7yl 390 5,37165
8gLzq 376 5,17254
8gzTu 390 5,04096
8hRbH 339 5,71291
8i9EF 381 5,10905
8p9RE 390 5,98221
8pfCR 390 5,35846
8uS3x 381 5,30560
8zs0c 374 5,49237
9r9v 383 5,01862
DFWs 465 9,03616
INuv 388 8,44247
KXMB 397 7,64214
YD6C 376 4,88283
gWPB 394 6,12164
qyYF 387 7,09046
sOqx 388 6,62535
vMWw 389 5,88735
xvLb 388 8,75663
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_40585
7CcOq
1 23,4% 269 2.627E-66
2 phalp2_37621
4ciq2
6 26,0% 407 2.246E-31
3 phalp2_20566
4xp9r
4 24,3% 353 5.119E-26
4 phalp2_15772
3TMNr
7 25,6% 378 3.223E-20

Domains

Domains
Representative sequence (used for alignment): 5ni24 (363 AA)
Member sequence: 5yodr (288 AA)
1 363 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959, PF08291

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5ni24) rather than this protein.
PDB ID
5ni24
Method AlphaFoldv2
Resolution 81.30
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50