Protein

Protein accession
5xUwT [EnVhog]
Representative
3RTMs
Source
EnVhog (cluster: phalp2_40377)
Protein name
5xUwT
Lysin probability
99%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
MARIDLHNFFKFYDEKNQNHVKAVQWLEDNLPVKYLEDNIDWAEIYRGKKGNAAPASEPTAAAPVVGGDDMPMMGLRLIKEFEGCHLKAYPDPLSGGLPITIGWGSTRKKDGGPFQLGDQITQQEADELLISQCKNQFLPSLRKIPHWNEMSDGKRGALLSFAYNLGAGFYGGDNFNTITRTLKNKEWDKVPDALYLYRNPGSNVEAGLARRRKAEGEAWKKS
Physico‐chemical
properties
protein length:223 AA
molecular weight:25047,1 Da
isoelectric point:7,72
hydropathy:-0,65
Representative Protein Details
Accession
3RTMs
Protein name
3RTMs
Sequence length
244 AA
Molecular weight
26982,42240 Da
Isoelectric point
8,73800
Sequence
MARIDLHNFFKFYDEKNPNHIKAVQWLEDNLPVKYLDDTVDWAEIYRGKKGSAVTAVAAKGSSTETIVCSKCGKGLAPVAAPVTPVTGGDDMPMTGLKLIKEFEGCHLKAYPDPLSGGLPITIGWGTTRKKDGSPFHMGDTITQQEADELLITQCKNQFLPSLRKIPHWNEMSDGKRGALLSFAYNLGAGFYGGDNFNTITRTLKNKEWDKVPDALYLYRNPGSNVEAGLARRRKAEGESWKKG
Other Proteins in cluster: phalp2_40377
Total (incl. this protein): 387 Avg length: 217,8 Avg pI: 8,04

Protein ID Length (AA) pI
3RTMs 244 8,73800
159yo 222 7,71387
15Y8q 223 8,89833
15ZJO 240 5,50499
15faN 222 7,65084
15gFG 223 7,72109
15hPx 224 7,73632
15iRT 223 8,71666
15lL3 222 8,40611
161nx 222 8,69306
166gB 222 6,84122
167mW 184 7,73990
17VWS 223 8,39715
1GvTZ 182 9,37353
1GvUv 236 9,12178
1I6vd 221 8,72916
1NPnw 225 7,72819
1NQAT 219 7,75775
1NQym 162 6,41788
1NYMH 199 7,84337
1NsGG 221 7,73774
1Nu8y 223 8,89833
1O2o3 167 8,48676
1Oa6W 223 7,73274
1Oadu 223 6,97064
1Oak7 224 8,30245
1Od5C 223 7,71609
1P8nM 221 8,39735
1P9G2 221 8,92502
1PNU0 221 8,67185
1PXWx 223 8,38722
1Pams 221 8,39747
1Pb1f 222 7,72529
1PctL 221 7,74274
1Ph5J 220 8,38716
1PhtI 220 8,72962
1PjpA 222 8,39567
1QaY0 221 8,75502
1QwTr 221 8,39747
1R96F 243 9,00045
1X6mW 223 7,73700
1XSpc 223 8,69364
1XWix 221 8,39735
1Ylng 223 8,70518
1ZDYl 220 8,72929
1ZIEq 203 6,42738
1ZMzB 222 8,42977
1ZSs7 241 8,74941
1ZTig 221 8,38716
1cP43 233 7,60485
1gtDM 241 5,37978
1iMVa 221 8,39754
1ixkC 160 9,66866
1jwT6 223 8,70473
1mO9K 222 8,39573
1nAtT 223 7,73723
1pXD7 223 8,36595
1uIVB 221 8,71666
1zCFU 223 8,91135
1zDdY 172 9,07749
20zgJ 223 8,91135
22L6C 204 7,82442
22MRp 220 8,69364
22OWr 221 8,38716
249Pl 221 8,67185
25zsI 185 9,07710
26RFm 177 8,81439
276v3 224 8,68172
27D7c 221 8,71666
27H5p 222 7,72154
27HuQ 217 6,91409
27Nx3 223 8,36595
27Pbr 223 8,36588
27QY3 222 8,39412
27UBP 223 6,91534
27YeZ 223 7,67761
27ZyR 223 8,36595
27aJj 177 9,02127
27bID 221 8,91122
27fZX 223 8,39573
27hp8 225 6,90812
27iD2 176 9,32118
27iVo 180 9,18702
27jRs 222 7,71580
27o6z 204 8,85236
27skM 223 8,37562
27xK7 222 8,41701
284EO 223 8,36595
2855P 222 8,40611
285gR 222 8,40618
287Zq 222 7,72609
2881f 222 7,72643
2LG1C 168 5,55564
2Qkh5 199 5,82534
2WhPt 205 6,97241
2X8gh 223 7,74212
2X8gl 221 8,40618
2XMq3 221 8,39399
2XMsP 222 7,72183
2XWKn 222 7,72592
2XkPI 224 7,73302
2YfI1 222 8,42816
2YfJg 222 6,91289
2Yxnb 241 8,23366
2awNO 236 8,63917
2bfrV 182 8,82064
2cURL 222 6,91153
2d4TC 223 7,74183
2d5ss 216 7,68562
2hEZi 223 8,70563
2qHO8 223 7,71171
2r4Z1 222 8,36595
2ro2Y 171 8,50842
31AFZ 221 7,06056
31IDG 222 8,38716
31L2W 204 7,73661
31QI6 222 8,38710
32XzK 223 8,38710
33D2O 230 7,60485
33II6 222 8,70518
33y7i 236 8,85017
35SA7 231 8,21361
37GZX 236 8,53956
37sBA 223 8,70518
3Ui3s 223 8,37730
3Wn8k 223 6,91460
3Y5jp 223 8,38710
3YEEZ 223 7,73263
3YvUB 223 7,72819
3ovY 221 8,70473
3qpc 223 8,39728
3zCjg 221 8,38555
3zCny 222 8,70473
40nJZ 182 8,80517
42b6Q 223 8,69409
42edi 237 9,00058
43EaH 221 8,39567
44l1c 223 8,68172
44n4I 223 6,91534
44naV 221 8,39567
4510r 223 7,72058
45FQr 182 9,02108
45Xuv 224 8,70428
45ZW1 223 7,73769
468pA 223 8,37904
46NVD 205 9,15878
46Qjk 224 7,74183
46i6k 233 8,21361
46k42 222 8,70473
46k47 221 7,01952
46lFa 224 8,70473
475A1 221 7,76286
477LY 223 7,73302
478Af 219 8,72987
4793N 221 8,30638
47K20 217 7,01896
47auG 216 8,34190
48K0m 222 8,39580
48Nw3 223 7,68181
48Oyw 223 7,73246
48haF 220 8,42004
49KF1 222 7,72075
49Sxn 223 7,72046
4ArK4 224 6,91460
4BSgZ 222 7,79747
4BSqr 223 8,69306
4BTa4 223 8,37730
4BVM7 223 6,97070
4BW9S 223 8,38716
4BYc5 181 8,84798
4C1HH 222 8,36595
4Ct8H 205 7,72694
4GiXf 205 9,23202
4O5rg 222 8,39573
4YABX 236 6,83616
4YBjK 222 8,70473
4ZW6k 223 8,70473
4ZeRg 222 8,72929
4aU2z 204 8,88608
4aYmb 223 8,38716
4atYM 223 8,71711
4bIth 221 7,71228
4bND8 223 8,38710
4bXAg 223 8,38716
4bXUu 217 6,60443
4bcrM 176 9,01792
4boKj 223 8,38716
4kNl5 221 7,73740
4lWqE 223 7,73302
4lbj3 210 8,97795
4mDB0 221 8,71621
4nTCP 223 7,73302
4p39r 223 7,73302
4pblL 222 8,38710
4pwMS 222 8,92470
4qgKv 222 7,72592
4qjXq 223 8,38548
4r7GL 231 6,43965
4rQQq 223 7,73302
4vmOB 221 8,39567
4zCfu 221 8,71666
4zmjw 209 8,42371
50KfY 221 8,38710
510Dr 231 6,91051
52HUs 221 8,71666
52IYU 208 8,75025
52WPZ 222 7,72592
54XNW 223 7,73263
54ctV 223 7,71171
54erN 223 8,38716
54fMS 222 8,39399
55mTT 222 8,71621
560Pu 223 8,70473
563Ku 222 8,38548
57FOQ 195 5,96374
58Z8H 204 8,54582
59Tgz 222 7,74775
59UJf 222 8,39399
5ABxE 225 8,39560
5Bwln 230 6,96831
5BxUA 224 8,38542
5DFKn 223 7,71171
5DyQ5 223 8,37730
5HhO7 223 6,45005
5Hk9F 205 8,72891
5IaDy 223 7,73263
5aS13 221 8,40457
5cG7l 223 7,73263
5czAC 222 8,64729
5d07I 224 7,68897
5dUVe 221 8,40457
5dUmz 221 8,40457
5dfRa 222 8,40457
5e9wr 224 8,70473
5fBAW 222 6,91176
5fSpB 223 7,73263
5fU2d 223 7,73302
5fx3L 224 8,71679
5gDLP 222 8,39399
5hO7l 223 8,69306
5i5ll 222 6,91176
5iPyn 221 8,72871
5j3bl 204 7,81191
5j74Z 223 8,36595
5kH3O 181 9,03623
5kKqi 223 8,38710
5kwGH 223 8,38548
5kzT4 222 7,68159
5lpJd 222 8,37730
5lwTC 222 7,73035
5m6wj 225 6,91051
5mcVa 222 8,36408
5mdvF 231 7,01270
5meHb 222 7,01276
5mg8x 222 6,91255
5mjya 223 6,84082
5mneN 219 8,40927
5mqqp 179 6,08322
5omFK 222 7,72592
5onlp 224 8,70473
5oooO 222 8,69306
5uUe5 223 8,38548
5uYF4 224 8,70473
5ufcR 200 6,21167
5uigV 223 7,73302
5ur5t 222 8,38548
5v7ud 223 7,73263
5v8H7 223 7,71609
5wjRn 223 7,73302
5wlgC 224 8,37730
5wmRn 161 5,94351
5x63c 222 8,91135
5x8nC 222 7,72558
5xLI8 222 7,72592
5xvro 227 6,96979
5ymoc 223 7,73263
5zbLR 223 7,73302
5zs21 207 6,85174
6Aeaw 222 7,72672
6GKnI 224 7,71688
6GSNa 230 7,70938
6GSv0 222 8,71621
6GXVr 223 8,38716
6GfL8 222 8,39567
6GfzA 222 8,41701
6Gh9P 222 8,39399
6HEMn 189 6,90488
6IoG9 223 7,73712
6IuHC 223 7,71171
6KUyV 231 6,43965
6Kb7B 224 7,72154
6LBWW 221 8,69306
6LDNa 224 8,69306
6LV2e 223 8,39722
6LXoz 223 8,38548
6LYDS 223 6,91415
6LZta 221 8,72916
6Lbxs 222 8,37562
6LxMS 224 7,71171
6LxR3 221 8,36595
6LzXz 194 8,37285
6M9Gz 205 9,16420
6MCGl 222 8,89833
6MCMZ 222 8,71621
6MELl 221 8,69306
6MKBN 222 8,39573
6MiKk 223 8,91135
6Mioa 222 8,69306
6QAGU 231 6,60187
6Qs2P 224 8,38710
6Qs4p 230 7,60485
6Qszv 221 8,38710
6VHdp 229 7,69392
6VSux 222 7,72643
6Y6FX 222 8,38374
6Y6Uw 222 8,69306
6Y864 221 8,69306
6x6WE 223 7,73302
6xLH0 221 8,70480
6xWZw 222 8,39399
6xbUH 223 8,37730
6xcjX 224 8,38542
6xm9P 180 9,25078
6xnxe 221 7,70858
6xpL3 223 8,38548
6zSri 223 8,70473
7UY2I 221 7,73035
7UgTt 223 7,71654
7Uh9O 221 8,39560
7Uhxf 222 8,38548
7WI25 223 8,91135
7Ygjd 208 9,00870
83cQX 223 8,41707
86j3q 221 8,70473
87fTy 223 8,68126
89q8q 224 6,91494
8frA4 222 6,91460
8m4zE 231 6,83997
8mWEG 218 7,74303
8mgSo 236 6,83741
8mzDH 224 8,70473
8nPeJ 221 8,38548
8rBL8 223 6,91585
8rVCP 223 8,39560
8rcrd 223 7,71171
8sNB3 221 8,39406
8tjKz 221 8,36595
DQ7n 223 8,70518
Dz1V 223 6,96729
EvIz 224 7,71171
FEBL 181 6,20138
FGWw 223 8,37730
FK81 200 7,79270
FOcu 210 9,22460
FirY 221 6,58374
Fizp 182 5,94345
FkqQ 224 8,37562
FnL0 186 5,60168
Fp8O 222 7,71143
FyqR 222 8,69306
G2pp 199 6,21730
GGEn 222 8,39412
GVe7 231 6,96831
Gayc 222 7,71660
Gcyw 192 8,75624
GdpB 184 5,40410
GnAq 191 8,82155
GpmZ 195 7,76747
Hav2 186 6,20138
IH35 221 7,71688
IHb0 178 8,83850
IOSm 178 6,20133
IQyd 180 6,09015
JLoW 224 8,36595
JN8b 226 8,38722
KU2R 222 8,70415
Mmr3 175 5,37722
Te5N 224 7,74257
hPml 221 8,72916
hT2S 231 6,84332
jJGd 182 6,90499
jPh7 223 6,90352
jW1o 222 8,40618
kX2T 223 8,39722
qAL2 221 8,39567
I3ULI0 195 7,72581
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_3745
5wa2f
396 75,6% 148 6.824E-83
2 phalp2_8851
2IyxA
73 34,0% 247 7.148E-29
3 phalp2_9745
82S7v
113 37,5% 149 9.048E-22
4 phalp2_2176
3Yhf4
930 32,9% 179 5.701E-21
5 phalp2_4451
31DIk
4919 37,6% 154 3.046E-19
6 phalp2_28113
7zmZV
50 34,8% 152 3.498E-18
7 phalp2_34307
3A2Hz
178 35,7% 154 5.412E-17
8 phalp2_6830
8n5Jv
121 36,9% 168 9.935E-17
9 phalp2_4532
3QBcV
9 33,7% 160 1.346E-16
10 phalp2_12815
8ixoy
26 31,2% 208 1.823E-16

Domains

Domains
Unannotated
GH24
Representative sequence (used for alignment): 3RTMs (244 AA)
Member sequence: 5xUwT (223 AA)
1 244 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3RTMs) rather than this protein.
PDB ID
3RTMs
Method AlphaFoldv2
Resolution 84.08
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50